KEGG   Oryctolagus cuniculus (rabbit): 100354652
Entry
100354652         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 24
  KO
K21097  C-C motif chemokine 24
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354652
   04061 Viral protein interaction with cytokine and cytokine receptor
    100354652
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100354652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354652
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100354652
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100354652
NCBI-ProteinID: XP_002723161
Ensembl: ENSOCUG00000021311
LinkDB
Position
Un
AA seq 113 aa
MAGPATIAASLLLLALSAHHFTPAGTVVIPSSCCMNFIPKKIPESQVVSYQLSSGSVCPR
AGVIFTTKKDYRVCGDPKQQWVQSYVRDLVAKWRRPSTGARTPGSRRPGEMRA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcaggccctgcaaccatcgcagccagcctcctgctgctggccctcagtgcccaccac
ttcacccctgcaggcaccgtggtcatcccctcctcctgctgcatgaactttattcctaag
aagatccctgagagccaagtggtgagctaccagctgtccagcgggagtgtctgccccagg
gcaggtgtgatcttcaccaccaagaaggactaccgagtctgcggcgaccccaagcagcag
tgggtgcagagctatgtgagggacctggttgccaagtggaggaggccttccacgggggcc
agaacgccaggcagcagacgtcccggagagatgcgtgcttga

KEGG   Oryctolagus cuniculus (rabbit): 100355784
Entry
100355784         CDS       T03373                                 
Symbol
CCL24
Name
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355784 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100355784 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100355784 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355784 (CCL24)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100355784 (CCL24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100355784
NCBI-ProteinID: XP_002711955
Ensembl: ENSOCUG00000025061
UniProt: G1SCU3
LinkDB
Position
6:26989613..26991642
AA seq 113 aa
MAGPATIAASLLLLALSAHHFTPAGAVVIPSSCCMNFIPKKIPESQVVSYQLSSGSVCPR
AGVIFTTKKGYRVCGDPKQQWVQSYVRNLVAKRRKPSTGARAPGGRRPGEMRA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcaggccctgcaaccatcgcagccagcctcctgctgctggccctcagtgcccaccac
ttcacccctgcaggtgctgtggtcatcccctcctcctgctgcatgaactttattcctaag
aagatccctgagagccaagtggtgagctaccagctgtccagcgggagtgtctgccccagg
gcaggtgtgatcttcaccaccaagaagggctaccgagtctgcggcgaccccaagcagcag
tgggtgcagagctatgtgaggaacctggttgccaagcggaggaagccttccacgggggcc
agagctccaggcggcagacgtcccggagagatgcgagcttga

DBGET integrated database retrieval system