KEGG   Oryctolagus cuniculus (rabbit): 100354913
Entry
100354913         CDS       T03373                                 
Symbol
SYVN1
Name
(RefSeq) synoviolin 1
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100354913 (SYVN1)
   04120 Ubiquitin mediated proteolysis
    100354913 (SYVN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354913 (SYVN1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100354913 (SYVN1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100354913 (SYVN1)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4 zf-rbx1 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_16 zf-RING_5 zf-RING_11 Prok-RING_4 zf-RING_15 zf-ANAPC11 zf-RING-like zf-C3H2C3 FANCL_C Endonuclease_7 RINGv
Other DBs
NCBI-GeneID: 100354913
NCBI-ProteinID: XP_017194957
Ensembl: ENSOCUG00000022650
LinkDB
Position
Un
AA seq 610 aa
MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGTLDFLFVSHAYHSTLTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQATDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPEPAEQGPPPAPHPPP
LLPQPPNFPQGLLPPFPPGMFPLWPPVGPFAPVPPPPSSGEAAVPPSSSAALAGPSGAAS
AAGPSATAPAPAPGTGPAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPE
ELRALEGHERQHLEARSHSLRNIHTLLDAAMLQINQYLTVLASLGPPRPAPAASPPEEAA
PTVAAAASTXALPSSEATTPSPGASPAAPETEKPAAPESVGTEELPEDGEPDAAELRRRR
LQKLESPVAH
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgttccgcaccgccgtgatgatggcggccagcctggcgctgaccggggccgtggtggcg
cacgcctactacctcaaacaccagttctacccgactgtggtgtatctgaccaagtccagc
cccagcatggccgtgctgtacatccaggccttcgtccttgtcttcctcctgggcaaggtg
atgggcaaggtgtttttcgggcagctgagggcggcagagatggagcaccttctggaacgg
tcctggtatgccgtgaccgagacttgtctggccttcaccgtgtttcgggacgacttcagc
ccccgcttcgtggcgctcttcactctcctcctcttcctcaaatgcttccactggctggcc
gaggaccgtgtggactttatggaacgcagtcccaacatctcctggctcttccactgccgc
attgtgtccctcatgttcctcctgggcactctggacttcctgttcgtcagccacgcctat
cacagcacgctgacccgtggggcctctgtgcagctggtgtttggcttcgagtacgccatc
ctgatgaccatggtgctcaccatcttcatcaagtacgtgctgcactccgtggacctccag
agcgagaacccctgggacaacaaggccgtgtacatgctctacacggagctgttcacaggc
ttcatcaaggtcctgctgtacatggccttcatgaccatcatgatcaaggtgcacaccttc
ccgctgtttgccatccggcccatgtacttggccatgaggcagttcaagaaagctgtgaca
gacgccatcatgtctcgccgagccatccgcaacatgaacactctgtacccagacgccacc
ccagaggagctccaggcgacagacaacgtgtgcatcatctgccgggaagagatggtgacc
ggggccaagaggctgccctgcaaccacatcttccacaccagctgcctgcgctcctggttc
cagcggcagcagacctgccccacctgccgcatggatgtgctgcgggcctcgctgccggcc
cagtcgccgccccctgagcctgcggagcaggggccgccccccgccccccaccccccaccc
ctgctgccccagcccccgaacttcccccagggcctcctgccgcccttccccccaggcatg
ttcccgctgtggccccccgtgggcccctttgcgcctgtcccgccaccccccagctcaggg
gaggccgcggttcctccatcctccagtgcagcccttgctgggcccagtggagcagcctcc
gctgccggccccagtgccactgcccctgccccggcgcctggcactggccccgcccccgag
gccggccctgcccccggcttccctttcccccctccttggatgggcatgccgctgcctccg
cccttcgccttccccccaatgcccgtgccccccgcgggcttcgccgggctgaccccggag
gagctgcgggctctggagggccatgagcggcagcacctggaggcccggtcgcacagcctg
cgcaacatccacacgctgctggacgccgccatgctgcagatcaaccagtacctcactgtg
ctggcctccctggggcccccccggcctgcccctgccgcgagcccccctgaggaggctgcg
cccacggtggccgccgccgcctccaccnnagccctccccagctccgaggccaccacccca
tcgccaggagcctccccagcagccccggagacagaaaagccagcagccccggagtcggtg
ggcaccgaggagctgcccgaggacggagagccagacgctgccgagctgcgccgccgccgc
ctgcagaagctggagtcccctgtggcccactga

DBGET integrated database retrieval system