KEGG   Oryctolagus cuniculus (rabbit): 100354948
Entry
100354948         CDS       T03373                                 
Symbol
BMP6
Name
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100354948 (BMP6)
   04390 Hippo signaling pathway
    100354948 (BMP6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354948 (BMP6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100354948 (BMP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354948 (BMP6)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100354948 (BMP6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta CoV_nucleocap
Other DBs
NCBI-GeneID: 100354948
NCBI-ProteinID: XP_008260576
Ensembl: ENSOCUG00000003431
LinkDB
Position
12:1470751..1647032
AA seq 429 aa
MQKENPFGAWGLPPPAPGPLHGLPASRSPPALPQPLAGEPPPGETEVPHPLFMLDLYNAL
SAADDEDGPSDAGGGSPGPRGGASSSQPGQSLPSAAHHLSRKSLLATGPGGGASPLTSAQ
DSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEAVTAAEFRIYKDCVV
GSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVLTPQHN
MGLQLSVVTQDGLHISPRAAGLVGRDGPYDKQPFMVAFFRVSGVHVRTTRSASGRRRQQS
RNRSTQSQDVSRVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGE
CSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRN
MVVRACGCH
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcagaaggagaatccgttcggtgcttggggactcccccccccggccccagggcccctg
cacgggcttccagcaagccgcagcccccccgcgctcccgcagcccctggcgggggagccc
cctcccggggagactgaagtcccgcaccccctgtttatgctggatctgtacaacgccctg
tccgccgccgacgacgaggacgggccgtcggatgcgggaggcggcagcccagggccccgc
ggaggggccagctcgtcgcagcccgggcagtcgctccccagcgccgcgcaccatctcagc
cgcaagagcctgctggccacgggaccgggaggcggcgcgtccccactgaccagcgcgcag
gacagcgccttcctcaatgacgccgacatggtcatgagctttgtgaacctggtggagtac
gacaaggagttctcccctcgccagcgacaccacaaagagttcaagttcaacctatcccag
attcccgagggtgaggcggtgacggctgcagaattccgcatctacaaggactgtgtggtg
gggagttttaaaaaccaaacttttcttatcagcatttatcaagtcttgcaggagcatcag
cacagagactctgacctgtttctgttggacacccgtgtcgtgtgggcctcggaggaaggc
tggctggaattcgacatcacggccaccagcaacctgtgggtgctgaccccacagcataac
atggggctgcagctgagcgtggtgacgcaggatggactccacatcagcccccgagccgca
ggcctggtgggcagggacggcccctacgacaagcagcccttcatggtggctttcttcaga
gtgagcggggtccacgtgcgcaccacccggtcagcgtctggccggcgccggcagcagagc
cgcaaccgctccactcagtcccaggacgtgtctcgggtctccagcgcttcagattacaac
agcagtgagctgaaaacagcctgcaggaagcatgagctgtatgtgagcttccaagacctg
gggtggcaggactggatcatcgcacccaagggctatgctgccaattactgtgacggagag
tgctccttccccctcaacgcacacatgaacgcaaccaaccacgccatcgtgcagaccctg
gtgcaccttatgaatcccgagtatgtccccaaaccgtgctgtgctccaactaaactcaac
gccatctcagttctctactttgacgacaactccaatgtcatcttgaagaagtacaggaat
atggttgtaagagcttgcggatgccactag

DBGET integrated database retrieval system