KEGG   Oryctolagus cuniculus (rabbit): 100355026
Entry
100355026         CDS       T03373                                 
Symbol
GDF6
Name
(RefSeq) growth differentiation factor 6
  KO
K20012  growth differentiation factor 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100355026 (GDF6)
   04390 Hippo signaling pathway
    100355026 (GDF6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355026 (GDF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355026 (GDF6)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100355026 (GDF6)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100355026
NCBI-ProteinID: XP_008253991
Ensembl: ENSOCUG00000008104
LinkDB
Position
3:complement(111889744..111907543)
AA seq 456 aa
MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGVRGRKEGKMPRAPRESSA
ARTPREREEPRAEDEPQRRPAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQSS
KSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVGAELRLFRQAPATPWGPPA
GQLHVQLFSCLSSLLLDERTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEAD
AAEVEARARGSQQPPPPPPDLRSLGFGRRVRSPQERALLVVFTRSQRKNLFAEMREQLGS
AEAAGPGAGAEGSWPPPSGAPDAGPWLSSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPL
HVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSC
CVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacacccccagggtcctgctctcggcagtcttcctcatcagtttcctctgggatttg
cccgggttccagcaggcttccatctcctcctcgtcgtcatccgccgagctgggctccacc
aagggcgtgcggggccgcaaggaagggaagatgccgcgagcgccgcgagagagttcggcg
gcccggacgccccgggagcgcgaggagccgcgggcggaggatgagccccagcggcggccg
gcgcaggagccgcctggccggggtccgcgcgtggtgccccacgagtacatgctgtcaatc
tacaggacttactccatcgccgagaagctgggcatcaatgccagctttttccagtcttcc
aagtctgccaatacgatcaccagctttgtagacaggggactcgacgatctctcgcacact
cctctccggagacagaagtatttgtttgatgtgtccacgctctcagacaaagaggagctg
gtgggcgcggagctgcggctctttcgccaggcgcctgcaacgccctgggggccgccggcc
gggcagctccacgtgcagctcttctcctgcctttcgtccctgctgctggacgagcggacc
ctggacccgcagggggcgcccccagccggctgggaagttttcgacgtgtggcagggcctg
cgccaccagccctggaagcagctgtgcttggagctgcgggccgcgtggggcgaggcagac
gccgcggaggtcgaggcgcgcgcgcggggatcccagcagccgccgccgccgcccccggac
ctgcggagtctgggcttcggccggagggtgcgatccccccaggagcgcgccctgctcgtc
gttttcaccagatcgcagcgcaagaacctgttcgccgagatgcgcgagcagctgggctcc
gccgaggctgcgggacccggggcgggcgcggagggctcctggccgccgccgtcgggcgcc
ccggacgccgggccttggctgtcctcgcccggccggcggcggcgacgcacggccttcgcc
agccgccacggcaagcgccacggcaagaagtcgaggctgcgctgcagcaagaagcccctg
cacgtgaacttcaaggagctgggctgggacgactggattatcgcgcccctagagtacgag
gcctatcactgcgagggcgtgtgcgacttcccgctgcgctcgcacctggagcccaccaac
cacgccatcatccagacactgatgaactccatggaccccggctccacccctcccagctgc
tgcgtgcccaccaaattgactcccatcagcatcctgtacattgacgcgggcaacaatgtg
gtctacaagcagtatgaggacatggtggtggagtcgtgcggctgcaggtag

DBGET integrated database retrieval system