KEGG   Oryctolagus cuniculus (rabbit): 100355079
Entry
100355079         CDS       T03373                                 
Symbol
EDA2R
Name
(RefSeq) ectodysplasin A2 receptor
  KO
K05163  tumor necrosis factor receptor superfamily member 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100355079 (EDA2R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355079 (EDA2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100355079 (EDA2R)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100355079 (EDA2R)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100355079
NCBI-ProteinID: XP_008270950
LinkDB
Position
X:complement(45565617..45597210)
AA seq 307 aa
MKALSLPTMDCQENEYWDQWGRCVTCQQCGPGQELSKDCGYGEGGDAYCTACPPRRYKSS
WGHHRCQSCINCAVINRVQKANCTPTSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTP
TSEVQCAFQLSLVKADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQR
VAGGSVQFEADEAAEEESLFPKPPGQETSTESPVSESIXEIQPLNPILDDDCSSTRGFPT
QESFTMASCASESHSHWVHTPIECTELDLQKFSSSASYTGAETLGGNADESSGDRLEPNV
PFEVASP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgaaggccttaagccttcccaccatggattgccaagaaaatgagtactgggaccaatgg
ggacggtgtgttacctgccaacagtgtggtcctggacaggagctctccaaggactgtggt
tatggagaggggggagatgcatactgcacagcctgccctccccgcaggtataaaagcagc
tggggccaccacagatgtcagagttgtatcaactgtgctgttatcaatcgtgtccagaaa
gccaactgcacgcctacctctaatgctgtctgtggggactgtctgcccaggttttaccga
aagacacgtattggaggcctgcaggaccaagagtgcatcccctgcacgaagcagaccccc
acctctgaggttcagtgtgccttccagttgagcttagtgaaggcagatgcacccacagtg
ccccctcaggaggccacacttgttgcactggtgagcagtctgctagtggtgtttaccctg
gccttcctggggctcttcttcctctactgcaagcaattcttcaacagacattgccagcgt
gttgcaggaggttcggtgcagtttgaggctgacgaggccgcagaggaggaatctctcttc
cccaagccacctggccaggagaccagcacagagtccccagtgagtgaaagcatcnttgag
atccagccacttaaccccatcctggatgacgactgcagctcgactcgtggcttccccaca
caggagtcctttaccatggcctcttgcgcctcagagagccactcccactgggtccacacc
cccatcgaatgcacagagttggacctgcaaaagttttccagctctgcctcctatactgga
gctgagacgttgggggggaacgcagacgaaagctctggagacaggctggagcccaatgtg
ccctttgaagttgccagcccttaa

DBGET integrated database retrieval system