KEGG   Oryctolagus cuniculus (rabbit): 100355119
Entry
100355119         CDS       T03373                                 
Symbol
ACVR1
Name
(RefSeq) activin A receptor type 1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100355119 (ACVR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355119 (ACVR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100355119 (ACVR1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100355119 (ACVR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100355119 (ACVR1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100355119 (ACVR1)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100355119 (ACVR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 100355119
NCBI-ProteinID: XP_002712242
Ensembl: ENSOCUG00000002439
UniProt: G1SHK1
LinkDB
Position
7:complement(96559085..96635693)
AA seq 509 aa
MVDGVMILPVLMMIAFPSPSMEDEKPKVNHKLYMCVCEGLSCGSEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFSGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggtagatggagtgatgattcttcctgtgctaatgatgattgcattcccctccccaagc
atggaagatgagaagcccaaggtcaaccacaaactttacatgtgtgtatgtgaaggtctc
tcctgtgggagtgaggaccactgtgaaggccagcagtgcttctcctcattaagtatcaat
gatggcttccatgtctaccagaaaggctgcttccaggtctacgagcagggcaagatgacc
tgcaagacgccgccatcaccgggccaggctgtggagtgctgccaaggggactggtgtaac
aggaacatcacggcccagctgcccactaaagggaagtcattttctggaacacagaatttc
cacctggaggttggcctcatcattctctcagtcgtgtttgcagtatgccttctagcttgt
ctcctgggagttgctctccgaaaatttaaaaggcgcaaccaagaacgcctcaatcctaga
gatgtggagtatggcaccattgaaggactcatcaccaccaatgttggcgacagcacttta
gcagatttactggatcattcatgtacgtcaggaagtggttctggtcttccttttctggta
caaagaacagtggctcgccagattacactattggagtgtgttgggaaaggcaggtacggc
gaagtatggaggggcagttggcaaggggaaaatgtagccgtgaagatcttctcctctcgg
gacgagaaatcttggttcagggagactgaattgtataacactgtgatgctgaggcatgaa
aatattttaggtttcattgcttcagacatgacatcaagacactccagtactcagttgtgg
ttaattacacattatcatgagatgggatccttgtatgactatcttcagctcactactctg
gatacagttagctgccttcgaatagtgctgtccatagccagtggtcttgcacatctgcat
atagagatatttgggacccaagggaaaccagccattgcccatcgggatttaaaaagcaaa
aacatcctggtgaagaagaatggacagtgctgcatagcagatttgggcttggctgtcatg
cattcccagagcaccaatcagcttgatgtgggaaacaacccgcgggtaggcaccaagcgc
tacatggctcccgaagttctagatgaaaccatccaagtggattgctttgattcttacaag
cgggttgatatttgggcctttggacttgttctgtgggaagtggccaggcgtatggtaagc
aatggtatagtggaggattataagccaccattctatgatgtggttcccaatgacccaagt
tttgaagatatgaggaaagtagtctgtgttgatcaacagaggccaaacatacccaacaga
tggttctcagacccgacactaacctctctggccaagctgatgaaagaatgctggtatcag
aatccatctgcaagactcacagctctgcgtatcaaaaagactttgaccaaaattgataat
tccctagacaaattgaaaactgactgttga

DBGET integrated database retrieval system