KEGG   Oryctolagus cuniculus (rabbit): 100355135
Entry
100355135         CDS       T03373                                 
Symbol
MPL
Name
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355135 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355135 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100355135 (MPL)
   04090 CD molecules [BR:ocu04090]
    100355135 (MPL)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  Prolactin receptor family
   100355135 (MPL)
CD molecules [BR:ocu04090]
 Proteins
  100355135 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N
Other DBs
NCBI-GeneID: 100355135
NCBI-ProteinID: XP_017201879
UniProt: A0A5F9DD04
LinkDB
Position
13:complement(123305458..123323252)
AA seq 635 aa
MPSWALFVVTSCLLLAPHSLTQVTSQDVSSLALGSEPLNCFSRTFEDLTCFWEEKRAAPS
GTYQLLYAYAGEKPRACPLSAQSVTSLGIRYICQFPAQDEVRLFVPLHLWVKNVFLDQNV
TERVLSVESVGLPAPPSIIQAAGGGRPGELQITWEASAPAIHDFLRHELRYGTADPRNTS
SPVVVQLLATETCCPTLQWPHPASGLQQHPCARPPGPQQDGPRQTAPTGEAPSVTASGGS
CLISGLQPGGSYWLQLRSQPDGVSLHGSWGSWSFPVTVDLPGDAEEIGLQCFTVDLRNVT
CQWQQQEHASSQGFFYHGRAQCCPRDRDPMWEKCEEEETTDPGAQPPEFSRCHFRARNDS
MVHVRVEVTTAQGAVHSYLGSPFWIHQAVLIPTPNLHWTEVSSGQLELEWQHSSPWAARE
TCYQLRYTGEGLQDWKVLEPPLGARRGTLELRPRSRYRLQLRARLNGPTYQGPWSAWSSP
ARVETASETAWISMVTALLLVLGLSALLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSESYEEVEPSLLEILPKSSERTPLPLCSSQVQLDYRGLQPSCLG
TTPLSVCPPMAEPGTCCTTHIANHSYLPLSCWQQP
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccctcttgggccctcttcgtggtcacctcctgcctcctcctggccccccacagcctg
acacaagtcaccagccaagatgtctcctcgctggccctgggctcagagccactgaactgc
ttctcccgaacatttgaggacctgacttgcttctgggaggagaaacgggcagcgcccagt
ggaacgtaccagctgctctatgcctatgcaggggagaagccccgtgcctgtcccctgagt
gcccagagtgtgacctccttggggatccgatacatatgccagtttccagcccaggatgaa
gtgcgcctcttcgtcccgctgcacctctgggtgaagaacgtgttcctggaccagaatgtg
accgagcgcgtgctctctgtggagagtgtgggcctgccagctccccccagcatcattcag
gcggcgggagggggacggcccggggaacttcagatcacctgggaggcctcagccccagcc
atccacgatttcctgaggcacgagctccggtatggcaccgcggatcccaggaacaccagc
agcccggtggtcgtgcagctgctcgccacagaaacctgctgccccaccctgcagtggccg
cacccagcctccggtctgcagcagcatccgtgtgctcggcccccggggccccagcaggat
ggaccacggcagaccgcccccactggagaagccccatctgtgacagcgtcgggcggaagc
tgcctcatctcagggctccaacctggcggctcctactggctacagctgcgcagccaacct
gacggggtctccctccacggctcctggggctcctggtccttccccgtcactgtggacctt
cctggggatgcagaggaaattggactacagtgctttaccgtggacctgaggaatgttacc
tgtcagtggcagcagcaggagcacgctagctcccaaggcttcttctaccacggccgggca
cagtgctgccccagagacagggaccccatgtgggagaagtgtgaagaggaggagacaaca
gatccaggagcacagccccccgagttctcccgctgccacttcagggcacgaaacgacagc
atggttcacgtccgtgtggaggtgaccacagcccagggtgctgttcacagctacttgggc
tcccctttctggatccaccaagctgtgctcatccccaccccaaacctgcactggacggag
gtctccagcggccagctggagctggagtggcagcactcgtccccctgggcagcccgagag
acctgctatcagctccgatacacaggagaaggcctgcaggactggaaggtgctcgagccg
cccctcggggcccggcgagggaccctggagctgcgcccgcgctctcgctaccgcttacag
ctgcgcgccaggctcaacggccccacctaccaaggcccctggagcgcctggtccagcccg
gccagggtggagaccgcctcggagaccgcctggatctccatggtgaccgctctgctcctg
gtgctgggcctcagtgccctcctgggcctgctgctgctgaggtggcaatttccagcgcac
tacaggagactgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggc
cagtaccttagggacactgcggccctgagtccgcctaaggccacagtctcagagagctat
gaagaagtggaacccagcctccttgaaatcctacctaagtcctccgagaggacacccttg
cccctgtgttcctcccaggtccagctggactaccgaggattgcagccttcttgtttgggg
accacgcccctgtctgtgtgcccaccaatggctgagccagggacctgctgtactacccac
atcgccaaccactcctacctcccactaagctgctggcagcagccctga

DBGET integrated database retrieval system