KEGG   Oryctolagus cuniculus (rabbit): 100355269
Entry
100355269         CDS       T03373                                 
Symbol
IL36G
Name
(RefSeq) interleukin 36, gamma
  KO
K05487  interleukin 36 gamma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355269 (IL36G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355269 (IL36G)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100355269 (IL36G)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100355269
NCBI-ProteinID: XP_002709614
Ensembl: ENSOCUG00000006660
LinkDB
Position
2:97749540..97754528
AA seq 162 aa
MSGAGQQIHGAMSEPYVGKLSDLDQQVWILQGQTLVTVPRSSNAAAVTITVMPCKYPEAL
EQGKGVPIYLGIQNPKMCLFCEDTGGQPTLQLKEQEILDLYNHTEPVKPFLFYHMQTGRT
STFESVAFPGWFIASFKKGQPIFLTSNQGKLYNTAFNLDLKA
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtcaggtgctggacaacaaatccatggagcgatgagtgagccttacgttgggaagctc
tccgatttggatcagcaagtgtggatcctccagggccagaccctggtgacagttccaagg
agtagcaacgcggcagcagtcaccatcactgttatgccgtgcaagtatccggaggctctt
gagcaaggcaaaggggttcccatttatctgggaatccagaatccaaaaatgtgtctgttc
tgtgaggacactggaggacaacccacattgcagctgaaagagcaggagatcctggacctg
tataaccacactgagcccgtgaagcccttcctgttctatcacatgcagacgggcaggacc
tccaccttcgagtccgtggccttccccggctggttcatcgcctccttcaagaagggccag
cctatcttcctgacttcaaaccaggggaaattgtacaacactgccttcaatttagatcta
aaggcttga

DBGET integrated database retrieval system