KEGG   Oryctolagus cuniculus (rabbit): 100355357
Entry
100355357         CDS       T03373                                 
Symbol
RAB10
Name
(RefSeq) RAB10, member RAS oncogene family
  KO
K07903  Ras-related protein Rab-10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100355357 (RAB10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355357 (RAB10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100355357 (RAB10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100355357 (RAB10)
   04031 GTP-binding proteins [BR:ocu04031]
    100355357 (RAB10)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    100355357 (RAB10)
 Protein recycling
  Rab GTPases and associated proteins
    100355357 (RAB10)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100355357 (RAB10)
  Exosomal proteins of other body fluids (saliva and urine)
   100355357 (RAB10)
  Exosomal proteins of colorectal cancer cells
   100355357 (RAB10)
  Exosomal proteins of bladder cancer cells
   100355357 (RAB10)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    100355357 (RAB10)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 AAA_7 TniB DUF3963
Other DBs
NCBI-GeneID: 100355357
NCBI-ProteinID: XP_002710022
LinkDB
Position
2:complement(159757490..159853830)
AA seq 200 aa
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL
GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN
SENVDISSGGGVTGWKSKCC
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggactcgggagtg
ggcaagacctgcgtcctttttcgcttttcggatgatgccttcaacaccacctttatttcc
accataggaatagactttaagatcaaaacagttgaattacaaggaaagaagatcaagcta
cagatatgggatacagcaggccaggagcggtttcacaccatcacaacctcctactacaga
ggagcaatgggtatcatgctagtgtatgacatcaccaatggtaaaagttttgaaaacatc
agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta
ggaaacaagtgtgatatggatgataaaagagttgtacctaaagggaaaggagaacagatt
gcaagggagcatggtattaggttctttgagactagtgcgaaagcaaatataaacattgaa
aaggctttcctcacattagctgaagacatccttcgaaagacccctgtaaaggagcccaac
agtgaaaacgtagacatcagcagtggaggcggcgtgacgggctggaagagcaagtgctgc
tga

DBGET integrated database retrieval system