KEGG   Oryctolagus cuniculus (rabbit): 100355519
Entry
100355519         CDS       T03373                                 
Symbol
UBE2K
Name
(RefSeq) ubiquitin conjugating enzyme E2 K
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100355519 (UBE2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355519 (UBE2K)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100355519 (UBE2K)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100355519 (UBE2K)
SSDB
Motif
Pfam: UQ_con UBA RWD UEV UBA_3 UFC1
Other DBs
NCBI-GeneID: 100355519
NCBI-ProteinID: XP_002709441
Ensembl: ENSOCUG00000005872
UniProt: G1SPV0
LinkDB
Position
2:28994726..29056827
AA seq 200 aa
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
VALSSKSWDVETATELLLSN
NT seq 603 nt   +upstreamnt  +downstreamnt
atggccaacatcgcggtgcagcgaatcaagcgggagttcaaggaggtgctgaagagcgag
gagacgagcaaaaatcaaattaaagtagatcttgtagatgagaattttacagaattaaga
ggagaaatagcaggacctccagacacaccatatgaaggaggaagatatcaactagagata
aaaataccagaaacatacccatttaatccccctaaggtccggtttatcactaaaatatgg
catcctaatattagttccgtcacaggggctatttgtttggatatcctgaaagatcaatgg
gcagcagcaatgactctccgcacagtattgttgtcattgcaagcactattggcagctgct
gaaccagatgacccacaagatgcagtagtagcaaatcagtacaaacaaaatcctgaaatg
ttcaaacagacagctcggctgtgggcgcatgtgtatgctggagcaccagtgtctagtcca
gaatacaccaaaaaaatagaaaacctatgtgctatgggctttgataggaacgcggtaatt
gtggccttgtcttcaaaatcatgggatgtagagacggcaacggagctgctcctgagtaac
tga

DBGET integrated database retrieval system