KEGG   Oryctolagus cuniculus (rabbit): 100355520
Entry
100355520         CDS       T03373                                 
Symbol
IL36A
Name
(RefSeq) interleukin 36, alpha
  KO
K05484  interleukin 36 alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355520 (IL36A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355520 (IL36A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100355520 (IL36A)
SSDB
Motif
Pfam: IL1 RE_AspBHI_N
Other DBs
NCBI-GeneID: 100355520
NCBI-ProteinID: XP_002709615
Ensembl: ENSOCUG00000014998
LinkDB
Position
2:97773096..97778036
AA seq 158 aa
MAKALSTPAPVLRHIQDLNHQVWVVQDQTLTAVPRKHSMVPATVSLIPCQYPETLETEKG
IPMYLGLDKPDVCLFCTKTREQPMLQLEDKNIMTLYHHPEPVKPFLFYHSKSGRTSTFES
VAFPGWFIAVCSEGGCPLFLTQDLGKAYTTDFELTPVN
NT seq 477 nt   +upstreamnt  +downstreamnt
atggctaaagcattatctacaccagcacctgtcttgaggcacattcaggatctcaatcat
caggtgtgggtcgttcaggaccagaccctgacagcagtgccaaggaagcacagtatggtt
ccagccactgttagcttaattccatgccaatatccagagactcttgagacagaaaaagga
atacccatgtacctgggattggataaaccagatgtttgcctcttctgtacaaagaccaga
gagcagcccatgttgcagctggaggacaagaacatcatgaccctgtaccaccaccccgag
cctgtgaagccctttctcttctaccacagtaagagtggcaggacctcaaccttcgagtcc
gtggccttccctggctggttcattgctgtctgctccgaaggaggctgcccgctctttctg
acccaagatctgggaaaagcctacaccacggactttgagttaacgcctgtgaattaa

DBGET integrated database retrieval system