KEGG   Oryctolagus cuniculus (rabbit): 100355759
Entry
100355759         CDS       T03373                                 
Symbol
ILK
Name
(RefSeq) integrin linked kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03320  PPAR signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu05100  Bacterial invasion of epithelial cells
ocu05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100355759 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100355759 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    100355759 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100355759 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100355759 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100355759 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100355759 (ILK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100355759 (ILK)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  MLK family
   100355759 (ILK)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    100355759 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Pkinase Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 100355759
NCBI-ProteinID: XP_002708812
Ensembl: ENSOCUG00000006593
LinkDB
Position
1:147608553..147614972
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggttgccgtgcgcctgtggctg
gacaacaccgagaacgacctcaaccagggggatgatcatggcttctcccctttgcactgg
gcctgccgagagggtcgctctgctgtggttgagatgctcatcatgcggggcgcacggatc
aatgtgatgaaccgtggagatgatacccccctgcacctggctgccagccatggacaccgt
gatattgtacagaagctgttgcagtacaaagctgacatcaatgcagtgaatgagcatggg
aatgtgcccctgcactatgcctgcttttggggccaagaccaagtggcagaggatctggtt
gctaacggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcg
aaggcacccctaagagagcttctccgagagcgggcagagaagatgggccagaatctgaac
cgtattccatacaaggacacattttggaaggggaccacccgcactcggccccgaaatggg
actctgaacaagcactctggcattgacttcaaacagctcaactttctggcgaagctcaac
gagaatcattcaggagagttgtggaagggccgctggcagggcaatgacatcgtggtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagagacttcaatgaggagtgtcct
cggctcaggattttctcgcatccaaatgttctcccagtgctaggagcctgccagtctcca
cctgctcctcacccaaccctcattacgcactggatgccatatggatccctctacaatgta
ctacatgaaggcaccaattttgtcgtggaccagagccaagctgtgaagtttgctttggac
atggcaaggggcatggcattcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccggatcagcatggccgatgtc
aagttctctttccaatgccctggacgcatgtatgcacctgcctgggtagcccctgaagct
ttgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacaagagaggtaccttttgctgacctctccaatatggagatt
ggaatgaaggtggcactggaaggccttcggcccaccatcccaccaggtatttccccccat
gtgtgcaagctcatgaagatctgcatgaatgaagaccctgctaagcgacccaaatttgac
atgattgtgcctatcctggagaagatgcaggacaaatag

DBGET integrated database retrieval system