KEGG   Oryctolagus cuniculus (rabbit): 100355779
Entry
100355779         CDS       T03373                                 
Symbol
UBA2
Name
(RefSeq) ubiquitin like modifier activating enzyme 2
  KO
K10685  ubiquitin-like 1-activating enzyme E1 B [EC:6.2.1.45]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100355779 (UBA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355779 (UBA2)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     100355779 (UBA2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   100355779 (UBA2)
SSDB
Motif
Pfam: ThiF UBA2_C UAE_UbL UBA_E1_SCCH NAD_binding_7 Pyr_redox
Other DBs
NCBI-GeneID: 100355779
NCBI-ProteinID: XP_008255502
Ensembl: ENSOCUG00000001464
LinkDB
Position
5:4224974..4265562
AA seq 640 aa
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFHPKANIIAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYASLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQADDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSDN
ANISEEERSRKRKLDEKDSVSAKRSRTGEPEELADVIALD
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggcactgtcgcgggggctacctcgggagctggctgaggccgtggccgggggccgggtg
ttggtggtgggcgcgggaggcattggctgcgagctcctcaagaacctcgtgctcaccggc
ttctcccacatcgacctgattgatctggacactatcgatgtcagcaacctgaacaggcag
tttttgtttcaaaagaaacatgttggaagatcaaaggcacaggttgccaaggaaagtgta
ctgcagtttcatccgaaagctaatatcatagcctaccacgacagcatcatgaacccggac
tataatgtggaattttttcgacaatttatattagttatgaatgctttagataacagagct
gcccgaaatcatgttaataggatgtgtttggcagctgacgtccctcttattgagagtggg
actgccggttatcttgggcaagtaactactatcaaaaagggtgtgactgagtgttatgaa
tgtcatcctaaaccaacccagagaacctttcctggctgtacaattcgtaacacaccttca
gaacctattcactgcatcgtttgggcaaagtatttgttcaaccagttgtttggggaagaa
gatgctgatcaagaagtgtctcctgacagagctgaccctgaagctgcctgggaaccaaca
gaagctgaagccagagccagagcatctaacgaagatggtgatattaaacgaatttccact
aaggaatgggctaaatcaactgggtatgatccagttaaactttttaccaagctttttaaa
gatgatatcagatatctattgacaatggacaaactatggcgaaaaaggaaacctccagtt
ccattggactgggctgaagtacagagtcaaggagaagaaacgaatgcatcagatcaacaa
aatgaaccccagttaggtctgaaagaccaacaggttctggatgtaaagagctatgcaagt
cttttttcaaagagcattgagactctgagagttcatttagcagaaaaaggggatggagct
gagctcatatgggacaaggatgacccatctgcaatggattttgtcacttctgctgcaaac
ctcaggatgcatattttcagtatgaatatgaagagcagatttgatataaaatcaatggca
gggaacattattcctgctattgctactactaatgcagtgattgccgggttgatagtattg
gaagggttgaagatcttatcaggaaaaatagaccaatgtagaactatttttttgaataaa
caaccaaacccaaggaagaaactccttgtgccttgtgcactggatcctcccaatcccaat
tgttacgtgtgtgccagtaagccggaggtgaccgtacggctgaatgtccataaagtgact
gttctcaccttacaggacaagatagtgaaagaaaaatttgctatggtagcaccagatgtc
cagattgaagatgggaaaggaacaattctgatatcttcagaagaaggagagacagaagct
aataatcacaagaagttgtcagaatttggaattagaaatggtagccggctccaagcggat
gactttcttcaggactatactttgttgatcaacatccttcatagtgaagacctaggaaag
gatgttgaatttgaagtggttggtgatgccccagaaaaagtggggcccaaacaggctgac
gatgctgctaaaagcataaccaatggcagtgacgacggagctcagccttctacctccaca
gcacaagagcaagatgatgtgcttatagttgattcggatgaagaaggcccttcagataat
gcaaacatcagcgaagaagagcgaagtcgcaagaggaaattggatgagaaagatagcgtc
agtgcaaagcggtcgcgcacgggagagcccgaagagctggcggatgtgatagcactggac
tga

DBGET integrated database retrieval system