KEGG   Oryctolagus cuniculus (rabbit): 100355862
Entry
100355862         CDS       T03373                                 
Symbol
IL17RA
Name
(RefSeq) interleukin 17 receptor A
  KO
K05164  interleukin 17 receptor A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
ocu04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355862 (IL17RA)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100355862 (IL17RA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100355862 (IL17RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100355862 (IL17RA)
   04090 CD molecules [BR:ocu04090]
    100355862 (IL17RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL17 receptor family
   100355862 (IL17RA)
CD molecules [BR:ocu04090]
 Proteins
  100355862 (IL17RA)
SSDB
Motif
Pfam: IL17R_fnIII_D1 IL17R_fnIII_D2 SEFIR
Other DBs
NCBI-GeneID: 100355862
NCBI-ProteinID: XP_008258098
Ensembl: ENSOCUG00000009160
LinkDB
Position
8:37751836..37777931
AA seq 873 aa
MGVPSLWPPVVRGPPLWLLLLLSGALAPGRAALHILDHPAPVCSQPELNCTVKNSTCLDD
SWIHPRNLTPSSPKDVQIQLHLAYTRSGDLVPVVHVEWMLQTDASILYLEGAELSILQLN
TNERLCVKFEFLSRLKHHHRRWRFSFSNFVVEPGQEYEVTVHHLPKPIPDGDPNHQSRNV
LVPGCEDPRMKMTTPCVSSGSLWDPSITVETLEAQQLRVSFTLWNESAHYLLLLNSFPHA
ENRSCFEHIHQIPAPAREDFHQRCNVTLFLHSSEWCCRHQVQIQPFFSSCQNDCLRHSVT
VSCPEILYVPDSVADFVPLWVYVFITGISIMLVGSVILLVICMTWRISGSHEKRGNDTRF
TGTPPAADLTPPPLRPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQVIS
EVGVVTWVGRQKQEMVESDSKIIVLCSRGTRAKWQAILGREEPAVQLRCDRWKPAGDLFT
VAMNVILPDFKKPACFGTYVVCYFSGISSESDVPDLFNITPRYALMDKFEEVYFRIQDLE
MFEPGRMHRIGELTGENYLQSPSGRQLKEAVQRFQEWQARCPNWFECENLGSADEQDPLS
LDEEVFEEPLLPPEGGIIRQRPLLQEPACQACVAVEPLVGEAEGGPSKLEPQLQPQGELA
AQALRTVLLPGQEVAVTHVLEPEPLADGSSTASRLAVVEEGEVCPLLGGHGPRRNSLLFL
PLDPEDSPLCSTPLESPEPLASPEPLAGAVREQLEGLMVSLFEQSLSCPGQEGWERPAVA
LKDLYTPHEEEQRQSVQSDQGYISRSSPQPPDGHADMEDGEEGEQGPAEHLSPEDLESLR
SLQHQLFFQELQKNSGWEGEGSDRAAAEGLASS
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgggggtcccgagcctttggccgcccgttgtccggggaccgccgctgtggctgctgctc
cttctctctggcgcgctggccccgggccgcgccgctctgcatatcttggaccacccggcg
cccgtctgctcgcagccggagctaaactgcacagtgaagaacagtacctgcctggatgac
agctggatccaccctcgaaacctgaccccctcatcacctaaagatgtccagatccagctg
cacttggcctacacccggtctggagaccttgtccctgtggttcacgtcgaatggatgcta
cagacagatgccagcatcttatacctggagggtgcagagctatccatcctgcagctgaac
accaatgagcgattatgtgtcaagtttgagtttctctccagactgaagcatcaccacagg
cggtggcgttttagcttcagtaactttgtggtggaacctggccaggagtacgaggtgact
gttcaccacctgcccaagccgatccccgatggggacccaaaccaccagtccaggaacgtt
cttgtgcccggctgcgaggaccccaggatgaagatgaccacgccgtgtgtgagctcaggc
agcctatgggaccccagcatcaccgtggagacgctggaggcccagcagctgcgggtgagc
ttcaccctgtggaacgagtctgcccactacctgctgctgctgaacagttttccccacgcc
gagaaccgcagctgcttcgagcacattcatcagatacctgcgcccgcacgggaggatttc
caccagcgatgcaacgtcacgctctttctgcacagctccgagtggtgctgccgccaccag
gtgcagatccagcccttcttcagcagctgccagaacgactgcctcagacactctgtgacc
gtctcctgccctgaaatcctctatgttccagactccgttgcagactttgtcccgctgtgg
gtgtacgtgttcatcacaggcatctccatcatgctggtgggctctgtcatcctgttggtc
atctgcatgacgtggaggatctctggatctcatgaaaaacgtggtaatgacaccagattc
actggcaccccgcctgcggctgacctgacccccccacccctgaggccaagaaaagtctgg
atcatctactcagccgatcaccccctctacgtggacgtggtcctcaagttcgcccagttc
ctgctcacagcctgcggcaccgaggtggccctggacctcctggaagaacaggtcatctcg
gaggtgggggtggtgacctgggtgggccgccagaagcaagagatggtggagagcgactcc
aagatcatcgtgctgtgctcccgaggtacgcgggccaagtggcaggccatcctgggccgc
gaggagcccgccgtccagctgcggtgcgaccgctggaagcccgcgggagacctcttcacg
gtggccatgaacgtgatcctcccagacttcaagaagccggcctgcttcggcacctacgtc
gtctgctacttcagcggcatcagcagtgagagcgacgtccccgacctcttcaacatcacc
cccaggtacgccctcatggacaagtttgaggaggtttatttccggatccaggacctggag
atgttcgagcctggccggatgcaccgcatcggggagctcacgggggagaactacctgcag
agccccagcggccggcagctcaaggaggccgtgcagaggttccaggagtggcaggcccgc
tgccccaactggtttgagtgcgagaaccttggctcggcggatgagcaggaccccctgtcc
ctggacgaagaggtgtttgaagagccgctgctgccccctgagggcggcatcatcaggcag
aggcccctactgcaggagcctgcctgccaggcttgtgtggcagtggagccgctggtcggc
gaggccgaggggggaccgtcgaagctggaacctcagctacagccccagggggagctggcg
gcccaggccctccgcaccgtgctgctccctgggcaggaggtcgccgtgacccacgtgcta
gaacccgagccccttgctgacgggagcagtacagcaagccggctggctgtggtggaggag
ggggaggtctgtccactgctggggggccatggcccccggcggaacagcctcctgttcctc
cccctggacccagaggactcgcctctctgcagcacgccgctggagtcaccggagccgctg
gcgtcaccggagccgctggctggggctgtcagggagcagctggaaggcctgatggtctcg
ctgtttgagcagagcctgagctgccccggccaggaggggtgggagaggcccgccgtggcc
ctcaaagacctgtacacgccgcacgaggaagagcagcggcagtcagtgcagtcagaccag
ggctacatctccaggagctccccgcagccccccgacggacatgccgacatggaggacgga
gaggagggggagcagggccccgccgagcacctctctcccgaggacctggagagcctgaga
agcctgcagcaccagctcttcttccaagagctgcagaagaactctggctgggagggcgag
gggtcagacagagcagccgccgaggggctggcctcttcctag

DBGET integrated database retrieval system