Oryctolagus cuniculus (rabbit): 100355912 Help Entry 100355912         CDS       T03373                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100355912    04151 PI3K-Akt signaling pathway     100355912   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100355912  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100355912  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100355912    04621 NOD-like receptor signaling pathway     100355912    04622 RIG-I-like receptor signaling pathway     100355912    04623 Cytosolic DNA-sensing pathway     100355912    04650 Natural killer cell mediated cytotoxicity     100355912  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100355912   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100355912    05161 Hepatitis B     100355912    05160 Hepatitis C     100355912    05171 Coronavirus disease - COVID-19     100355912    05164 Influenza A     100355912    05162 Measles     100355912    05168 Herpes simplex virus 1 infection     100355912    05163 Human cytomegalovirus infection     100355912    05167 Kaposi sarcoma-associated herpesvirus infection     100355912    05169 Epstein-Barr virus infection     100355912    05165 Human papillomavirus infection     100355912   09171 Infectious disease: bacterial    05152 Tuberculosis     100355912   09163 Immune disease    05320 Autoimmune thyroid disease     100355912   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100355912   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100355912  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100355912 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100355912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100355912 NCBI-ProteinID:  XP_002708111 Ensembl:  ENSOCUG00000031030 UniProt:  A0A7R8GV81 LinkDB All DBs Position 1:46572719..46573288 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDRRSSMLLGQMRRVSPLSCLQDRHDFE CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI LQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacaggaggtcctccatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc ttgcaagaaagaatttggagcaaggaatga

DBGET integrated database retrieval system