Oryctolagus cuniculus (rabbit): 100355920 Help Entry 100355920         CDS       T03373                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04072   Phospholipase D signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04218   Cellular senescence ocu04371   Apelin signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04810   Regulation of actin cytoskeleton ocu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100355920    04014 Ras signaling pathway     100355920    04371 Apelin signaling pathway     100355920    04072 Phospholipase D signaling pathway     100355920    04024 cAMP signaling pathway     100355920  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100355920    04137 Mitophagy - animal     100355920   09143 Cell growth and death    04218 Cellular senescence     100355920   09142 Cell motility    04810 Regulation of actin cytoskeleton     100355920  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100355920  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100355920  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100355920    04031 GTP-binding proteins [BR:ocu04031]     100355920 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100355920   Exosomal proteins of bladder cancer cells    100355920 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100355920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  100355920 NCBI-ProteinID:  XP_051707701 Ensembl:  ENSOCUG00000011362 LinkDB All DBs Position 1:complement(169847534..169930470) Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc ggcggaggcggcgtgggcaagtcggcgctcaccatccagtttatccagtcatatttcgtc acggattatgatccgaccattgaagattcctacacaaagcagtgcgtgatagacgacaga gctgcccggctagatattttggatacagcaggacaagaggagtttggagccatgagagaa cagtatatgaggaccggtgagggtttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataaatttcaaagacagattctcagagtaaaggatcgtgatgaattt ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtcacacaggaa gaaggacagcagttagcgcggcagcttaaggtaacatacatggaagcctcagcaaagatt agaatgaatgtagatcaagctttccatgaacttgttcgggttataaggaaatttcaagag caagaatgtcctccttcaccggaaccaactcggaaagaaaaagacaagaaaggctgccat tgtgtcattttctaa

DBGET integrated database retrieval system