KEGG   Oryctolagus cuniculus (rabbit): 100356207
Entry
100356207         CDS       T03373                                 
Symbol
UBE4B
Name
(RefSeq) ubiquitination factor E4B
  KO
K10597  ubiquitin conjugation factor E4 B [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100356207 (UBE4B)
   04120 Ubiquitin mediated proteolysis
    100356207 (UBE4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100356207 (UBE4B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100356207 (UBE4B)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   100356207 (UBE4B)
SSDB
Motif
Pfam: Ufd2P_core U-box
Other DBs
NCBI-GeneID: 100356207
NCBI-ProteinID: XP_008264165
Ensembl: ENSOCUG00000016997
LinkDB
Position
13:complement(140155265..140283500)
AA seq 1363 aa
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRESPPGPPLAASAPGPSQSLGLNVHNM
TPATSPIGAAGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVACEKSMSQV
DVDSGIENMEVDENDRREKRSLGDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLMLNAGSNPGTSPMFCSVGSFGASSLSSLYETSPTPIASFWSSVPTLGPPSASPSRAA
SQVATPSASASLSPHSTASGTALGSQPSSPRYRPYTVTHPWGGAPCPTPRSPSISVPSSS
PSLRALTSSPQAVPTSSSRQRPSSMGPPFPPASPSATRRRPSPLRTSPSVYDNPFSFLFL
ALAGDSSDEEDEEDDDDDGDDDDEGGGGGDDVSCVQFGSSLGASGGASSWDSYSDHFTIE
TCKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNVRSQCISHTALVLQGSLTQP
RSLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDND
YFKYPLMALGELCETKFGKTHPVCNLVASLPLWLPKPLSPGSGRELQRLSYLGAFFSFSV
FAEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALG
YMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRIT
LPNDETRVNATMEDMSSWRAELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRR
LRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESF
LRRCLNFYGLLIQLLLRVLDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYS
PQVLYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPSVQPRTQKFFEMIENH
PLSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNS
GKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMRNKEQWEQLPRDQQQARQSQLAQD
ERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVE
NPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTI
AIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIIL
RHLLNSPTDPFNRQPLTESMLEPVPELKEQIQAWMREKQNSDH
NT seq 4092 nt   +upstreamnt  +downstreamnt
atggaggagctgagcgctgatgagattcgtcggaggcgccttgcacgacttgctggtgga
cagacctcccagccgaccaccccgctcacctctccccagagggagagccctccaggacct
cccctagcagcatcagcccccggtccctcccagagtctaggtctcaatgtccacaacatg
accccagctacctccccaataggtgcagcaggagtagcccatcgaagccagagcagtgaa
ggagtcagttctctgagcagctcgccctccaatagccttgaaacgcaatctcaatctctc
tcacgttcccagagcatggatatcgatggtgtcgcttgtgagaaaagcatgtcccaggtg
gatgtggattcaggaattgaaaacatggaggttgatgaaaacgatcgaagagagaagagg
agcctcggtgacaaggagccttcctcgggccctgaggtgtccgaagagcaggccttacag
ctggtctgtaagatcttccgcgtctcttggaaggatcgcgacagagatgttatctttctt
tcttctctttctgcacagtttaagcagaacccaaaagaagtgttctctgattttaaggac
ttaattggccagattttaatggaagtactaatgatgtctactcagacgagagatgaaaac
ccctttgccagtctgacagccacatcccagcccattgcagcagcagctcggtcaccagac
agaaatctcatgctgaatgctggctccaacccaggaacaagccccatgttctgcagtgtg
ggctccttcggggccagctctttgtctagcctctatgaaactagccctacccccattgcc
agtttctggagctctgtgcccacgctaggtccaccctctgcctcaccctcccgggcagcc
agccaggtggccacgccttctgcctctgcttccctcagtcctcacagcacagcttctgga
actgctctaggaagccagccctcgtctccccgctatcgcccctacactgtcacccacccg
tgggggggtgccccctgtcccaccccccggtcccccagcatcagcgtcccgtcaagctcc
ccaagcctccgtgcgctcaccagtagcccccaggcagtacccactagcagttccagacag
cggcccagcagcatgggcccgcccttcccgcccgcctcgcccagtgctacacgcagacgt
ccgtcccccctgaggacctctcctagtgtgtacgacaatcccttctccttcctcttcctc
gcacttgctggggacagtagtgatgaagaagatgaagaggatgatgatgatgatggtgat
gatgatgatgaaggtggtggtggtggtgatgatgtttcttgtgtccagtttgggtccagt
ttgggagcctctggtggagcaagcagttgggattcctacagtgaccattttaccattgaa
acctgcaaagagaccgatatgctgaactacctcattgagtgttttgaccgagttggaata
gaggaaaaaaaagcaccaaagatgtgcagccagcccgcggtcagccagctcctgagcaac
gtccgctcacagtgcatctcccacactgcgctggtcctgcagggctccctcacgcagccc
aggtccctgcagcagccgtccttcctagtgccgtacatgctgtgtaggaatctcccctac
ggcttcattcaagagctggtgagaaccacgcaccaggatgaagaagtgttcaagcagatc
tttatccccattttgcaaggcctggctcttgctgccaaagagtgctccctcgataacgac
tactttaaataccccctcatggcattaggtgaactctgtgaaaccaagtttgggaagacg
caccctgtgtgcaatttggttgcctccttgccattgtggttgccgaaacccttaagccca
ggctctgggcgggagctgcagagactctcttacctgggggccttcttcagcttctctgtc
ttcgccgaggacgatgttaaagtggttgaaaagtatttctcagggcctgccattaccctg
gaaaacactcgtgttgttagccaatcactacagcattacttggagttgggaaggcaagag
cttttcaagattctgcatagtattttgttaaacggcgaaacccgtgaggccgctctgggt
tacatggcagccgtcgtcaacgccaatatgaagaaagcgcagatgcagacagatgataga
ttagtatctacagacggatttatgctgaatttcctttgggtactacagcagctaagtaca
aaaatcaagttagaaacagttgatccaacgtatatcttccacccaagatgccggattact
ctccccaatgatgagacgcgcgtgaacgccacgatggaggacatgagcagctggcgggct
gagctctacggtgatcagcctccattttctgagccgaaattccccactgagtgcttcttt
ctcaccctgcacgcccaccacctctccattcttcctagttgccgtcgctacatccgcagg
ctccgagccatcagggagctcaacagaaccgtggaagatttgaaaaataacgagagccaa
tggaaagactcgcccctggcgaccagacaccgcgagatgctgaagcgctgcaagactcag
ctcaagaaactggtgcggtgcaaggcctgtgctgacgcgggcttgctggacgagagcttc
ctgagacgttgtctgaacttctacggccttctcatccagctgctgctgcgcgtcctggac
cccgcgtaccccgacataacactgcctttaaattcagatgtccccaaggtatttgcagcg
ttgcctgagttttatgtagaagatgttgcggaatttttattttttattgtacaatactct
cctcaggtgctgtacgagccctgcactcaggacattgtgatgttcctcgtggtgatgctg
tgcaaccagaactacatccggaacccctacctggtggccaaactggtggaggtcatgttc
atgaccaacccgtccgttcaaccacgaacccagaagttttttgaaatgattgaaaaccac
cctctctccaccaaactgctggtcccttccctgatgaagttttacacagatgtggagcac
accggagccaccagcgagttctacgacaagttcacaattcgctaccacatcagcaccata
tttaaaagcctctggcaaaacatagctcaccacggcaccttcatggaggagttcaactcc
gggaagcagtttgtccgctacatcaacatgctgatcaacgacacgacgttcctgcttgat
gagagtctggagtccctgaagcggatccacgaagtgcaggaagagatgaggaacaaggag
cagtgggagcagctgccccgggaccagcagcaagcccggcagtcccagctggcccaggac
gagcgtgtgtcccgctcttaccttgccctggccaccgaaaccgtggacatgttccacatc
ctcaccaagcaggtccagaagccgttcctcagacccgagctcggcccccgcctggctgcg
atgctgaacttcaatcttcagcagctctgtggccccaagtgccgcgacctgaaggttgag
aaccctgagaagtacggcttcgagccaaagaagctgctggaccaactgacggacatttac
ctacagctggactgtgcgcgattcgctaaggccattgccgacgaccagaggtcctacagc
aaagaactgttcgaggaggtgatctccaagatgcggaaggcggggatcaagtccacgatc
gccatcgagaagttcaagctcctggccgagaaggtggaggagatcgtcgccaagaacgcc
cgcgcggagatcgactacagcgacgccccggatgagttcagagaccctctgatggacacc
ctgatgactgaccccgtgaggctgccctctggcaccatcatggaccgttccatcatcctg
cggcacctgctcaactcccccaccgaccccttcaaccggcagccgctgaccgagagcatg
ctggagccagtgcccgagctgaaggagcagatccaagcgtggatgcgcgagaagcagaac
agcgaccactga

DBGET integrated database retrieval system