KEGG   Oryctolagus cuniculus (rabbit): 100356265
Entry
100356265         CDS       T03373                                 
Symbol
CLCF1
Name
(RefSeq) cardiotrophin-like cytokine factor 1
  KO
K05421  cardiotrophin-like cytokine factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356265 (CLCF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356265 (CLCF1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100356265 (CLCF1)
SSDB
Motif
Pfam: PRF CNTF
Other DBs
NCBI-GeneID: 100356265
NCBI-ProteinID: XP_002709284
Ensembl: ENSOCUG00000003943
UniProt: G1SKR8
LinkDB
Position
1:complement(194810857..194819469)
AA seq 225 aa
MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
YLNYLGPPFNEPDFNPPRLGAETLPRATVNLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGHPLPQPLPGTEPAWAPGPAHSDFLQ
KMDDFWLLKELQTWLWRSAKDFNRLKKKVQPPAAAVTLHLEAHGF
NT seq 678 nt   +upstreamnt  +downstreamnt
atggacctccgagcaggggactcgtgggggatgttagcttgcctgtgcaccgtgctctgg
cacctccctgcagtgccagctctcaaccgcacaggggacccggggcctggcccctccatc
cagaagacctatgacctcacccgctacctggagcaccaactccgcagcttggctgggacc
tacctgaactacctgggcccccccttcaacgagcctgacttcaacccaccgcggctgggg
gcagagactctgcccagggccacggtcaacctggaagtgtggcgaagcctcaatgacaaa
ctgcggctgacccagaactacgaggcctacagccacctcctgtgttacctgcggggcctc
aaccgtcaggctgccacggccgagctgcgccgcagcctcgcccacttctgcaccagcctc
cagggtctgctgggcagcattgcaggtgtcatggcggccctgggccacccactgccccag
cccctgcccgggactgagcccgcctgggcccctggccctgcccacagcgacttcctccag
aagatggacgacttctggctgctgaaggagctgcagacctggctgtggcgttcagccaag
gactttaaccggctcaagaagaaggtgcagcccccggcggctgcggtcaccctgcacctg
gaagcccacggcttctga

DBGET integrated database retrieval system