KEGG   Oryctolagus cuniculus (rabbit): 100356276
Entry
100356276         CDS       T03373                                 
Symbol
WASHC5, KIAA0196
Name
(RefSeq) WASH complex subunit 5
  KO
K18464  WASH complex subunit strumpellin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100356276 (WASHC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356276 (WASHC5)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100356276 (WASHC5)
SSDB
Motif
Pfam: Strumpellin DUF3106
Other DBs
NCBI-GeneID: 100356276
NCBI-ProteinID: XP_002710586
Ensembl: ENSOCUG00000015785
UniProt: G1TA82
LinkDB
Position
3:complement(140737572..140811414)
AA seq 1159 aa
MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRVDQQKYGDIIFDFSY
FKGPELWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTIETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNMDDICKLLRSTGYSSQPGARRPPNYPESYFQRVPISESFISMVIGRLRSDDIYNQVSA
YPLPEHRSTALATQAAMLYVILYFDPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
AEAWEPYKAAKTALNNTLDLSNVKEQASRYATVSERVHAQVQQFLKEGYLREEMVLDTIP
RLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILTDSRYNPKILFQLLLDTAQF
EFILKEMFKQMLAEKQAKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIIGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHKGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSMYQSTHIPIPKFVPVDESVTFIGRLCREILRITDPKMTCHV
DQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RDRTVQDTLKTLMNAVSPLKSIVANSNKIYLSAIAKTQKIWTAYLDAIMKVGQMQILRQQ
IANELHYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPVVNFLFLIAQLPKLQYSKNLGMVCRKPADPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFIRSTVEQCTSQKIPEMPAEVVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgctggactttctagccgagaacaacctctgtggccaggccatcctgaggattgtttcc
tgcggcaatgccatcattgctgaactcttgaggctgtcggagttcattcctgctgtgttc
aggttaaaagaccgagttgatcaacagaaatatggagatatcatatttgatttcagctat
tttaagggtccagagttatgggaaagcaaactggaagctaaaccagagctacaggattta
gatgaagaatttcgtgaaaacaacatagaaattgtgaccagattttatttagcgtttcaa
agtgtgcataaatatattgtagacttaaacagatatctagatgacctcaatgaaggggtc
tatattcagcagacaatagaaactgtgcttctcaatgaagatggaaagcaacttctgtgt
gaggcactgtacttgtatggagtgatgctgctggtcattgatcagaagattgagggagaa
gtcagagagaggatgctggtctcctactatcgatacagtgctgctcgatcttctgctgat
tccaatatggatgatatttgtaagctgcttcgaagtacaggttattccagccaaccagga
gccagaagaccacccaactatcctgagagctatttccagagagtgcctatcagtgaatcc
ttcatcagtatggtcattggtcgcctgagatctgatgatatctataaccaggtctcggca
tatcccttgccagagcatcgcagcactgccctggcaacccaagccgccatgctgtatgtg
attctctacttcgacccttccatcctgcacacccatcaggcaaaaatgagagagatagtg
gataaatattttccagataactgggtcatcagcatttacatggggatcacggttaatctg
gctgaagcttgggaaccttacaaagccgccaaaaccgccttaaacaataccctggacctc
tcaaatgtcaaagaacaggccagcaggtacgctaccgtgagtgagcgagtgcacgcgcag
gtgcagcagtttctgaaagagggttatttacgggaggagatggttctggacacgatccca
aggctgctgaactgcctgagagactgcaatgttgccatccgatggctgatgcttcataca
gcagactcagcttgtgatccaaacaacaaacgccttcgtcaaatcaaggaccagattcta
acagactccaggtacaaccccaagatcctcttccagttgctgttggatactgcacagttt
gagtttatactcaaagagatgttcaagcagatgctggcagaaaagcaagccaaatgggag
cattataagaaggagggctcagagcggatgactgagcttgcagatgtcttttcgggagtg
aaaccgctaaccagagtggagaaaaatgaaaatcttcaagcttggttcagagagatctca
aaacagatattgtctttaaattatgacgattctactgctgcaggcagaaaaaccgtgcaa
ctaatacaagctttggaggaggttcaagaatttcaccagttggaatcaaatctgcaagtg
tgtcagtttcttgccgacactcgcaagtttctgcatcagatgatcagaaccatcaacatc
aaagaggaggtcctcatcacaatgcagatcatcggggacctttcctttgcttggcagctc
attgacagtttcacatccatcatgcaagaaagcatcagagtcaacccgtccatggtgacg
aaactcagagctacattcctaaagcttgcctctgccctcgacctgccccttcttcgtata
aatcaggcaaatagccctgaccttctcagcgtgtctcagtattattctggtgaattggtg
tcttatgtgagaaaggttttgcagatcattccagaaagcatgttcacatctctcctgaag
atcataaagcttcagacccacgatatcattgaagtgcctacccgcctggacaaagacaag
ctgcgggactatgcccagctcgggccccgatacgaggtcgccaagcttactcacgctatt
tccatttttactgaaggcatcttaatgatgaaaacgactttggttggcatcatcaaggtg
gatccgaagcagttgctggaagatggaataaggaaagagctggttaaacgtgttgccttt
gcccttcataagggactgatattcaaccctcgggccaagccgagtgaattgatgcccaag
ctgaaagaattaggagccaccatggatggatttcaccgttcttttgagtacattcaggac
tatgtcaacatctatggcctgaagatttggcaggaagaagtatctcgtattataaattat
aatgtggagcaagagtgtaataacttcttaagaacaaagattcaagattggcaaagtatg
taccagtccactcacatcccgataccgaagttcgtccccgtggacgagtctgtcacgttc
atcggccggctctgcagagagatcttgcggatcacagacccgaaaatgacgtgtcacgta
gaccagctgaacacttggtacgatatgaaaactcatcaggaagtgaccagcagccgcctc
ttctcagaaatccagaccaccctgggcactttcggtctgaatgggttagacaggcttctg
tgcttcatgattgtgaaagagctgcagaatttcctgagtatgtttcagaaaattatcctg
agagacagaactgttcaggatactttaaaaaccctcatgaatgctgtcagccccctaaaa
agtattgtagcaaattcgaataaaatttatctttccgccattgccaaaacacagaagatt
tggaccgcttatctcgatgctataatgaaggtcgggcagatgcagattctgcggcagcag
atcgccaatgaactccattactcctgtcggtttgactccaagcatctggcagcggctctg
gagaacctcaataaggcgctcctggcggacatcgaagcccattatcaggacccctcgctt
ccgtaccccaaagaagataacacgctcctctatgaaatcaccgcctatctggaggcagct
ggcattcacaacccactgaataagatatacataacaacaaagcgcttgccctatttccca
gttgtcaactttctatttctgatcgctcagttgccaaaacttcagtacagcaaaaatcta
ggaatggtctgccgcaagcccgccgaccccgtcgattggccgccgctcgtcctggggctg
ctcaccctgctgaagcagtttcactcccgctacacggagcagttcctggcgctgatcggc
cagttcatccgctccacagtggagcaatgcacaagccagaagatcccagagatgcctgcc
gaggtcgtgggtgccctgctcttcctggaggactacgtccgctacacaaagctgcccaga
cgggttgctgaagcacatgtgcctaatttcatttttgatgaattcagaacagtcctataa

DBGET integrated database retrieval system