KEGG   Oryctolagus cuniculus (rabbit): 100356333
Entry
100356333         CDS       T03373                                 
Symbol
IL16
Name
(RefSeq) interleukin 16
  KO
K22628  interleukin 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356333 (IL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356333 (IL16)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100356333 (IL16)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 DUF6272
Other DBs
NCBI-GeneID: 100356333
NCBI-ProteinID: XP_008273506
LinkDB
Position
Un
AA seq 1373 aa
MSLQRRVFPRRENGIHEVAAKPSALATRQPRAREQERKKGSFTSSLRMEPRGRSGKSRKS
AKFRSISRSLILCNAKTSDDGSSPDERYPDPFELSLGQGEEGIFHSSVQLADTSEAGPSS
FPDLALASEAAPLAAAGSDRGKACRKMLFTKESSATSSRGKPGKPEAQSNFLFPKACHHR
TRSNSTSVNPYCTGDIDFPTTKKSAALADRQPYSLCSNRKSLSQQLDCPAAKATGTSRPT
RSLSTAQLVQPSGGLQASVISNVVLMKGQAKGLGFSIVGGQDSIYGPIGIYVKTIFAGGA
AAADGRLQEGDEIVELNGESMAGLTHQDALQKFKQAKKGLLTLTVRTRLTVPPAVCSQLS
PPLSRSLSSSTCVAKDSGGFALDSPAAPGSSTIKPNYRIMVEVSLKKEAGVGLGIGLCSV
PYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEINDTPVHCLTLNEVYAILSHCSPGPV
PIIVSRHPDPQVSEQQLKEAVAQAVENFKFGKERHQWSLEGVKRLESSWHGRPTLEKERE
KTSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPSSGGGGTAQQPSDQEVSRHSPSPRLSQE
PGASPPASSRPPQDSPRLSESPDEHPPVRLKKSFEIFVRKPTSSKPKPPPRKYFKSDSDP
QKSLAEAENATSPPGHALPACGQEARELLPLLSPQEDTAGRGPHATVSCPGAGIDPQAPS
TTESEPGRRRSSPVTQTSPLKHPLLKRQARMDYSFETTPEDPWVRISDCIKSLFSPMMSE
SHSHLPLQPHASLREEDGQQGHLEGTCAPKLDAAHGAAKVHKAADSGTGKKGPPVAPKPA
WFRQSLKGLRSRASPAQPIAASSREPPGPHVQASSSSSSSIKQRISSFETFGSSQLPDRG
VQRLSLHASPGEAAKPSGKQEGGRFSGLLGRGAPPTAEPRQQEQHQLSRGSPAAPEASDP
GVSESPPQGQKPRPQPLPTEPDPLQRLLPSRPEASPGPVLKVPGQRARSFPLTRTQSCET
KLLDEKSSKLYSISSQVSSAVMKSLLCLPSAAAWGQAPCSPREGVPPRPASREDAAPDSS
AEAPTSDTGFSLNLAELREYTEGLAEPQDAEDAAPCPQSGQSVISLLSSEELRKLIEEVR
DLDEATLKQLDSIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQK
GNEVLSINGKSLKGTTHNDALAILRQARDPRQAVIVTRRPAPEASPGLSPSSDSAAAPSA
ASDVPAESATEAAICTVTLEKTSAGLGFSLEGGRGSLRGDKPITINRIFKGVASGPSATL
QPGDEILHVAGTALQGLTRFEAWNIIKALPDGPVTVVIRRGLQPQGTVATGDP
NT seq 4122 nt   +upstreamnt  +downstreamnt
atgagtctgcagcggagggtcttcccgagaagggagaacggcattcatgaagtggccgct
aagcccagtgcgctcgccacccgtcagccccgggcccgggagcaggagaggaagaagggc
agcttcacctcctctctgaggatggagccacgcggccgttccgggaagagcagaaagtcc
gcaaaattccgctccatttcccggtccctgatcctctgtaatgctaagaccagtgatgat
ggctctagccctgatgagagatatcctgacccctttgagttgtcgctgggccagggcgag
gaggggattttccactcatccgtgcagctggcagacacgtcggaagccgggcccagcagc
tttcctgatctagcgctggcctccgaggctgctccactggcagcagctgggagcgatcga
ggcaaagcctgtaggaagatgctcttcacgaaggaatcctctgcaacttcctctcgtgga
aagccaggaaaaccagaggcacagagtaacttcctgttccctaaggcctgccaccacagg
acacgcagcaactcaacgagtgttaatccctactgcactggagacattgattttcccacg
accaagaaatctgcagcattggcagaccggcagccttattctctgtgtagtaacaggaag
tccctctcgcagcaactggactgtccagcagcaaaggccacgggcacgtcacgaccaacg
cggtcactgagcacggcccagcttgtacagccgtctgggggtctccaggcttcggtcatc
tccaatgttgtgctgatgaagggccaggcgaagggcctgggcttcagcatcgtcgggggg
caggacagcatctatggccccattgggatttacgtcaaaaccatctttgctggaggagcc
gctgctgccgacggacggttacaagaaggtgatgaaattgtggaactcaacggggagtcc
atggctgggctgacgcaccaggatgccttgcagaagttcaagcaagccaaaaaggggctc
ctcaccctcaccgtgaggacccgcctgacggtgccgcccgcggtgtgcagccagctctcc
ccgccgctgagccgctccctgagctccagcacctgtgttgccaaggacagcggcggcttt
gccctggacagccccgcggcccctggcagcagcaccatcaaacccaactacagaatcatg
gtggaggtgtctctgaagaaagaggctggcgttggcctgggcatcggcctgtgcagcgtc
ccgtacttccagtgtatctcaggcatttttgtgcacacgctctcaccaggctctgtggcg
catctggacggacggctccggtgtggcgatgagatcgtggagatcaacgacacccctgtg
cactgcctgactctcaatgaggtctacgccatcctgagccactgcagtcccggtccagtc
cccatcatcgtcagccgacatccagacccccaggtgtctgaacagcaactcaaggaagct
gtggctcaggctgtggagaacttcaagtttggaaaggagaggcaccagtggagtctggaa
ggcgtcaagaggctggagagcagctggcacgggcggcccaccttggagaaggagcgggag
aagacctcggcacccccccaccgcagggcgcagaaggtcatgatccgctccagcagcgac
agcagctacatgtccgggtccccggggggcagccccagcagcggcggcggtggcacagcg
cagcagccctccgatcaggaagtcagcaggcacagccccagcccgcgcctgagccaggag
ccaggggcttctcccccagcctcgtccaggccaccccaggacagcccgcgcctctctgag
agcccagacgagcacccgccagtgcggctgaagaaatccttcgagatatttgtgaggaag
cccacatcctccaagcccaaacctccacccaggaaatacttcaaaagcgacagcgaccct
cagaagagtctggcagaggccgagaacgccacgagccctcctgggcatgccttgcccgcc
tgcggccaggaagccagagagctgctgccactgctgtcgccgcaggaagacacggcaggg
agagggccccacgccaccgtcagctgccccggagctggaatcgaccctcaggctccgtcg
accacggagagtgagccaggaaggaggaggtccagcccagtgacccagacgtccccactg
aaacaccccctgctgaagcggcaggctcggatggactatagcttcgagaccacccccgaa
gacccctgggtgagaatttccgactgcatcaaaagcttgttcagccccatgatgagtgag
agccacagccacctgcccctgcagccccacgccagcctgcgtgaagaagacgggcagcag
ggccacttggaggggacctgtgccccgaagctggacgctgctcatggcgctgccaaagtg
cacaaggcagcggacagcggcactgggaagaaggggccccctgtggcccccaagccagcc
tggtttcgccaaagcttgaaaggtttgaggagtcgcgcttcgccagcacagccaatagct
gcctcctccagggagccccccgggccacacgtgcaggcctcctcctcctcctcttcctcc
atcaagcagagaatcagctctttcgagaccttcgggtcctctcagctgcctgacagggga
gtccagagactgagcctgcatgcgtcccctggggaggcagcaaaaccttccgggaagcaa
gaggggggccggttctctggcctcttggggagaggggctccgcccaccgccgaaccccgg
cagcaggagcagcatcagctgtcccggggttcccctgcagccccagaggccagtgacccc
ggggtgtctgagtcccctccccaaggacagaagccccgtccgcaacccctccccaccgag
ccggacccactccagaggctgctgccatcccggcccgaggcatctccagggccggtgcta
aaggtgccaggccagcgggctcggagtttccccctgaccaggacccagtcgtgtgagacg
aagctcctggacgagaagagcagcaaactgtactccatcagcagccaggtgtcgtcggct
gtcatgaaatccttgctgtgcctcccgtccgccgcggcctggggccaggctccctgcagc
cccagggagggggtgccgcccaggccggcctcccgcgaggacgcagcgcccgacagctct
gcagaagcccccacctcggacaccggcttctctctcaatctggcggagctgcgagaatac
acggagggcctcgcggagccccaggacgccgaggacgcggctccctgcccacagtcgggg
cagtctgtgatctccctgctgagctccgaagagctgagaaagctcatcgaggaagtgagg
gatctggatgaagcaaccttaaagcaattggacagcatccacgtcaccatcctacacaag
gaggagggagccggcctggggttcagcttggcaggaggggcggatctggaaaacaaagtg
attacggttcacagagtgtttccaaatgggctagcctcccaggaaggcaccattcagaag
ggcaatgaggttctttccatcaacggcaagtccctcaaggggaccacgcacaacgatgcc
ctggccatcctccgccaagcgcgagacccacggcaagcagtgattgtcacaaggaggccg
gctccagaggcctcgcctggcctgagcccctccagtgactctgcggcagcaccctctgca
gccagcgatgtccctgcagaatccgcaacggaggctgccatctgcaccgtgaccttggag
aagacctcagcagggctgggcttcagcctggaaggtgggaggggctcgctgcgcggagac
aagcccatcaccatcaaccggatcttcaaaggggtagcgtcgggaccgagtgcgacactc
cagccgggagacgagatcttgcacgtggccggcaccgccctgcagggcctcacccgcttc
gaggcctggaacatcatcaaagccttgcccgacggacctgtcactgttgtcattaggaga
ggcctccagccacaggggaccgtggccactggggacccctag

DBGET integrated database retrieval system