KEGG   Oryctolagus cuniculus (rabbit): 100356631
Entry
100356631         CDS       T03373                                 
Symbol
OSMR
Name
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356631 (OSMR)
   04151 PI3K-Akt signaling pathway
    100356631 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356631 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100356631 (OSMR)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100356631 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 100356631
NCBI-ProteinID: XP_008260351
Ensembl: ENSOCUG00000012643
LinkDB
Position
11:59881012..59953194
AA seq 979 aa
MAVISISGTTLLLALLSLRTLQSLVLDERLLLTPELINISINSEHQSLHLQWTVPNLPHQ
ESRMAFQIQISRFERSKVIWEENYRSTVKQGQVLHWSWESELPLECGPHFVRMKSEVVDA
KFPKPSFWSSWSPWEKVVAQDSPGPNELLVFPKDKLVEEGSSVTLCYVSGSNLKNISCYL
DSEQIPGERLDASVFAFSLSNIPFIRKTGTNFFCGNSTHKEDGTVLFVSKVLEEPKDFSC
ETRDFKTLKCTWEPGPDTGLAWSKQPSQSYTLLESFSRRKEHCQHRSWCHWQISQGSQET
YNFTLLAENRLRRRSVNLLFNLTRRVHPMDPQSIKFENVSARSAIMTWKEYSIVNHCTLL
CQVELRAEGEVTQQHNVSVKVNGEYVLSGLEPGTQYATQVRCASASHFWKWSDWVPQKII
TFEAAPSEAPDVWRNVTSEPGRQNVALFWKPLSKHQANGKILFYNVVIENLDSASRLQLL
SIPAPATQQELMLDPRCSYRIHVTANNSVGTSPASIVAVAGDPGNGTENVKEERITGTDG
GFPLSWKPKSGDVAGYVVDWCAHPRDTSCDFQWKHVGPNTTSTVISSDSFEPGVRYSFRI
YGLSTKRIAYLLAKKTGYCQELAPSYNPQVTIKNLTSHSFTLSWEDYSTESQPSFILGYH
VYLKSKAMQCHPGFGERTHSDDSVCCKYKIDNPEKKMFVAENLQPESLYEFLVTPYTSVG
EGPNGTFINITTQDEHPNILIRIILPMILCVLLIMILCYWKSQWMKEECYPDIPDPYKSS
ILSMKKSKENPHPTIMNVKDCIPDAIEVINKAEGTKTQFPGTRKSVTETELTSQPVYLCL
IATENNYSSPGPCICFENLTYNQEVSASDSCGHGPVTPEEPPSQLGLLASSGSFLKALEK
NYTNSLEENPSGNSLRYVSQLASPLSGDKESLPTNPPMLVLCSEYKMQTAVPSCLASPPL
SEDSSLSSVTLLGESEHYS
NT seq 2940 nt   +upstreamnt  +downstreamnt
atggctgtcatttccatctctgggacgacattgctcttggcattgctgtccttgaggact
ctgcagagcctagtcttggatgaacgtttactcttgactcctgaattgattaacatttcg
atcaattctgaacatcaaagcttgcatttacaatggactgtccccaaccttcctcatcag
gaatccagaatggcgtttcagatacagatcagtagatttgaaagatccaaggtcatctgg
gaggaaaactaccgcagcaccgtgaagcagggccaagtccttcattggagctgggagtct
gagctgcctttggaatgcgggccgcactttgtgagaatgaagagtgaggtggttgacgcc
aagttccccaagccgagtttctggagcagctggagtccctgggagaaagttgttgcccag
gattctccaggaccgaatgagttgcttgttttccctaaagataagcttgtggaggaaggc
tccagcgtcactctgtgttacgtttccgggagcaacctaaagaacatatcctgctatttg
gacagtgaacagatccccggagaacggcttgacgccagtgtatttgcattcagtttgagt
aacattcctttcatcaggaaaacggggacaaatttcttctgtgggaacagcacgcacaaa
gaagacggcactgttctgtttgtttcaaaagtactcgaggagcccaaggacttttcttgt
gaaacccgggacttcaagacgctgaagtgcacttgggaacctggaccagacactggcttg
gcttggtctaagcaaccttcccagagctacactttgctggagtcattttccaggagaaag
gaacactgtcaacacagaagctggtgtcattggcaaataagtcagggctcacaggaaaca
tataatttcacactgctggctgagaaccgtttaaggaggagaagcgtcaacttgcttttc
aacttgactcgtcgagtccatccaatggatccccagagcatcaagtttgaaaatgtaagt
gccaggagtgccatcatgacgtggaaggagtactccattgtgaatcactgcacactgctg
tgtcaggttgaactccgtgctgaaggagaggtaacacagcagcacaacgtgtctgtgaag
gtgaatggtgagtatgttttaagcggactggagcctggcacacagtatgcaacccaagtg
cgctgcgctagcgccagccacttctggaaatggagcgattgggttcctcagaagatcatc
acatttgaagctgctccctcagaggctcccgatgtctggaggaatgtgacgtcagagccg
ggacgtcagaacgtggccttattctggaagccactatccaaacaccaagccaatggaaag
atcctgttctataatgtagttatagaaaacctagactcagcatccaggttacagctcctc
tccatccctgcaccagccactcagcaagaactaatgcttgacccacgatgttcttaccga
atccacgtcacagccaataacagtgtgggcacctcccccgcctcgattgtggctgtcgct
ggagaccccggaaatggtacagaaaatgttaaagaagaaaggattacagggacagatggt
ggattccctctgtcttggaaaccaaagtctggagatgttgctggctacgtggtggactgg
tgtgcacatccccgggacacttcctgtgatttccagtggaagcacgtgggtcccaacact
acaagcacagtcatcagctcagattcttttgaaccgggagtccgatacagcttcagaatt
tacggactgtctacaaaaaggattgcttatttactagcgaaaaaaacaggatactgccag
gaattggctccttcatacaatcctcaagtgaccataaaaaacttgacatcccactccttc
actctgagctgggaggattattccacagaatcccaacccagttttatacttggctaccac
gtctatctcaagtccaaggcaatgcagtgccacccaggatttggagagagaacgcattca
gatgattcagtatgttgcaaatacaaaattgacaacccagaaaagaagatgttcgttgca
gaaaacctacagccagaatccttgtatgagttcctcgtcactccgtatacaagcgttggg
gaaggccccaatggcactttcataaacatcacaactcaggatgaacaccccaatattctt
atccgtatcatactgcccatgattctttgcgtcttgctcatcatgatcctgtgttactgg
aaaagtcaatggatgaaggaggagtgttaccctgacatcccagatccttacaagagcagc
atcctgtcaatgaaaaaatccaaggagaatcctcacccaacaataatgaatgtcaaggac
tgcattccagatgctattgaagttataaacaaggctgaagggactaagacacagttcccg
ggcaccaggaagtcagtgacagaaactgaacttactagtcaacccgtctacctttgcctc
attgcaacagaaaacaattactccagccctggaccctgtatctgctttgagaaccttacc
tataatcaggaagtttctgcgtctgattcctgtggccatggcccagtaacccctgaagaa
cctccgagtcagctgggactactggcctcatctggcagtttcctcaaggcactggaaaaa
aactacacgaactccctggaagagaaccccagtggaaacagtttgcgttatgtgtcccag
ctggcttcacccttgtctggagacaaggagagtctgccaacaaacccaccaatgctggtg
ctgtgttcagagtataaaatgcaaacggcagtgccctcatgccttgcgtcgcctccactc
agtgaagacagcagcctctcctcagttacccttttaggtgaaagtgaacactacagttag

DBGET integrated database retrieval system