KEGG   Oryctolagus cuniculus (rabbit): 100356641
Entry
100356641         CDS       T03373                                 
Symbol
IFNLR1
Name
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356641 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356641 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100356641 (IFNLR1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL10/28 receptor family
   100356641 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 100356641
NCBI-ProteinID: XP_002716066
Ensembl: ENSOCUG00000001490
LinkDB
Position
13:129170805..129199944
AA seq 633 aa
MVQRNQSPSPGALPVAAAAAGRSLGRPQVIPGRLRLPLAAARVTCRPASRAGREESGPRA
GGRPCPGGRTWQEPAGGPPLLLCLLQTAPGRPALAPPQNVSLLSQNFSVYLTWLPGPGNP
QDVTYFVAYQSSPSPRWRRVDKCAGTRELVCSLMCLKNQDLYNKFRGRVRVASPSAKSSW
VESKYLDYLFEVELAPPTLLLTHMEEILSVNATYQLPPCMPPLDLKYEVEFWKEGTRNKI
PFPVTPYGQAVWVPLQPTASGWHCLHARTIHTFIVPRYSKFSKPSCFFLEAPAANLAFLV
MPSLLPPLLVVATGGVIWKSLMGSPWFQRAKTPQALVFSGPRCPVATLQPSGPESLETLL
LCPRKELTRRAPGGAQAGSESRAGAEEARDDPASSEEDSDDSACFQPYLGAPPFLRREPP
AAGHAETEGSRPGSAGAPTPPGPSSGSSAWDCSGRSWASAGEASWPWAEAGSSECLAKRG
LGPEPGGSEHPGPPPPGAFSQGMDSLAEPLQDDPGSWATWSSPPPRLGLLPGEPPVSLRT
LTFCWDSSPEEEEEEEEGEEEEEEEDRRESESEHSDLGSSGAETLQRPEVGGRVPGHYMA
RSAGLQPLTPPGAPAGFSKHSAPQQDPGAYVPR
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtgcaacgaaaccaaagcccgagcccgggcgccctcccggtggctgcggcggcggcg
gggaggtccctggggaggccccaggtaattcccgggcgactccgcctcccattggctgcc
gcccgcgtcacctgccggcccgcgagccgagccgggagggaggagtcggggccccgggcc
ggcgggcggccgtgcccgggcggacggacatggcaggagcctgccggtgggcctcccctg
ctgctgtgcctgctgcagaccgctccagggaggcccgctctggcccctccccagaacgtg
tcgctgctctcccagaacttcagcgtgtacctgacgtggctcccaggccctggcaacccc
caggacgtgacctactttgtggcctaccagagctctccctcccccaggtggcgcagagtg
gacaagtgtgcaggaacccgcgagctggtgtgttccctgatgtgcctcaagaatcaggac
ctgtacaacaagttcagggggcgagtgcgggtggcttcgcccagcgccaagtcctcctgg
gtggaatccaaatacctggattacctctttgaagtggagctggccccgcccacgctgctg
cttacccacatggaggagatcctgagtgtcaatgccacctaccagctgcccccttgcatg
cccccgctggacctgaagtatgaggtggagttctggaaggaaggcaccagaaacaagatc
ccatttccagtcactccatacggccaggcagtctgggtgccccttcagcccacggccagc
ggctggcactgcctccacgccaggaccatccacaccttcattgtccccagatacagcaag
ttctccaagcccagctgctttttcctggaggccccagcagccaacctggccttcctggtg
atgccgtctcttctgccgccgctgctggtcgttgccacgggaggtgtgatctggaagagt
ctcatggggagcccctggtttcaacgggcaaagacaccgcaggctctggtgttttctggc
cccagatgtcccgtggcaaccctgcagcccagcgggccggagtccctggagaccctgctc
ctctgtccccggaaggaactgaccagaagggctccaggcggcgcgcaggcggggtcggag
agcagagctggagccgaggaggcccgggatgaccctgcgagctccgaggaggactccgat
gacagcgcctgcttccagccctacctcggcgcgccccccttcctgaggcgagagcccccg
gctgcgggccacgctgagacggaggggtcccggccaggctcagcgggggctcccacgcct
ccaggccccagcagtggctcctctgcctgggactgctccgggagaagctgggccagcgcc
ggggaggcctcctggccctgggccgaggctggctcctctgaatgtttggccaagaggggc
ctgggcccagagccgggggggtctgagcatccagggcctccacccccaggggcgttctcc
cagggcatggactccctggcggagcccctgcaggatgaccctggctcctgggccacctgg
agctccccacccccgcggctgggtctgctccctggggaacccccagtttcacttcggaca
ctgaccttctgctgggacagcagccctgaggaggaggaggaggaggaggaaggggaggaa
gaggaggaggaagaagacaggagggaatcagaaagtgagcacagtgacctgggtagctcg
ggggctgagaccctgcagaggcccgaggtcgggggcagggtgccggggcactacatggcc
aggtcagccggcctccagcctctcaccccacccggcgcccccgccgggttctccaagcac
tcggcaccccagcaggaccccggagcctacgtcccccgctga

DBGET integrated database retrieval system