KEGG   Oryctolagus cuniculus (rabbit): 100356652
Entry
100356652         CDS       T03373                                 
Symbol
CSF3
Name
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu05144  Malaria
ocu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356652 (CSF3)
   04151 PI3K-Akt signaling pathway
    100356652 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356652 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100356652 (CSF3)
   04657 IL-17 signaling pathway
    100356652 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100356652 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    100356652 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356652 (CSF3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100356652 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 100356652
NCBI-ProteinID: XP_017204801
Ensembl: ENSOCUG00000009701
LinkDB
Position
19:41226682..41230857
AA seq 192 aa
MALQLLLWLGALWAVQEAAPPGPASSLPQGFLLKCSEQVRKIQADTSMLQEELCATHKLC
HPEELLLLGHSLGIPRAPLSSCSSQALQLPGCLSQLHSGLLLYRGLLQALAGISPASAPA
LDKLQLDVADFATTIWHQMEDLGQAPAVQPTQSTMPALTSAFQRRAGSVLVASHLQSFLE
LTYRVLRYLAQP
NT seq 579 nt   +upstreamnt  +downstreamnt
atggccctgcagctgctgctctggctcggtgcactctgggcagtgcaagaagctgcgccc
ccaggccctgccagctccctgccccagggcttcctgctcaagtgctcagagcaagtgcgg
aagatccaggctgacacctcgatgctgcaggaggagctgtgcgccacccacaagctgtgc
caccctgaggagctgctgctgctcgggcactctctgggcatcccgcgggctccgctgagc
agctgctccagccaggccctgcagctgcccggctgcctgagccaactccacagcggcctc
ctcctctaccgcggcctcctgcaggccctggcggggatttccccggcctcagcgccagcc
ctggacaagctgcagctggatgtcgccgactttgccaccaccatctggcaccagatggag
gacctggggcaggctcctgccgtgcagcccacccagagcaccatgccagccctcacctct
gccttccagcgccgggcgggcagcgtcctggtcgcctcccacctgcagagcttcctggag
ctgacctaccgtgtcctgcgctacctggcccagccctga

DBGET integrated database retrieval system