Oryctolagus cuniculus (rabbit): 100356678 Help Entry 100356678         CDS       T03373                                  Name (RefSeq) interferon alpha-1/13   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100356678    04151 PI3K-Akt signaling pathway     100356678   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100356678  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100356678  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100356678    04621 NOD-like receptor signaling pathway     100356678    04622 RIG-I-like receptor signaling pathway     100356678    04623 Cytosolic DNA-sensing pathway     100356678    04650 Natural killer cell mediated cytotoxicity     100356678  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100356678   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100356678    05161 Hepatitis B     100356678    05160 Hepatitis C     100356678    05171 Coronavirus disease - COVID-19     100356678    05164 Influenza A     100356678    05162 Measles     100356678    05168 Herpes simplex virus 1 infection     100356678    05163 Human cytomegalovirus infection     100356678    05167 Kaposi sarcoma-associated herpesvirus infection     100356678    05169 Epstein-Barr virus infection     100356678    05165 Human papillomavirus infection     100356678   09171 Infectious disease: bacterial    05152 Tuberculosis     100356678   09163 Immune disease    05320 Autoimmune thyroid disease     100356678   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100356678   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100356678  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100356678 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100356678 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon DUF6559 Motif Other DBs NCBI-GeneID:  100356678 NCBI-ProteinID:  XP_002708113 UniProt:  A0A7R8GUY5 LinkDB All DBs Position 1:46622389..46622958 Genome browser AA seq 189 aa AA seqDB search MASAFCLVLVLVVFNCMSVCALNCDLPQTHSQNNKETFKKLREMRKVMGFFCMQYIHDFG LPREELEGHQVQKAQTIAVLHEVTQGVFTLFCAPDSSATWNNTILDILCSRLHQQLSDLE ACVKQEVEVKQTPTIQNPSVRAVNKYFRNIRLYLTEKEDSPCAWMTVTLEVSRAMSLSRF LQERLRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcctcggcattttgtcttgtgctggtgctggtagtattcaactgtatgtctgtctgt gctctgaattgtgatctacctcagactcacagccagaataacaaagaaactttcaagaag ctgagagaaatgaggaaagtgatgggcttcttctgcatgcagtacattcacgattttggg ttaccacgggaggagcttgaaggacaccaggtccagaaggctcaaactattgctgtgctg catgaggtgacccagggggtcttcacacttttctgcgcaccggactcatctgctacctgg aacaataccatcctggacatactgtgctctagactccaccagcagctgagtgacctggaa gcctgtgtgaagcaagaagtggaggtgaaacagacacccacgatacagaatccctctgta cgagctgtgaataagtacttcagaaatatccgcctctatctgacagagaaggaagacagc ccttgtgcctggatgactgtcacactagaagtttcgagagccatgtctttatcaagattc ttgcaagaaagattaagaagtaaggattga

DBGET integrated database retrieval system