KEGG   Oryctolagus cuniculus (rabbit): 100356820
Entry
100356820         CDS       T03373                                 
Symbol
UBE2U
Name
(RefSeq) ubiquitin conjugating enzyme E2 U (putative)
  KO
K10584  ubiquitin-conjugating enzyme E2 U [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100356820 (UBE2U)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100356820 (UBE2U)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100356820 (UBE2U)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100356820 (UBE2U)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100356820
NCBI-ProteinID: XP_002715992
Ensembl: ENSOCUG00000000932
UniProt: G1SED1
LinkDB
Position
13:complement(102197600..102259663)
AA seq 320 aa
MNRRVFLLLEKHFQEFRENNYTGITAFPTSEDMMEWEAEIEGLQDSMWQGLIFELTIDFT
PEYNFVPPVVKFRTIPFHPNVDPYTGQPCIDFLDNPEKWNTSYTLSSILLTLQVMLSNPG
LEQPVNLEAAQMLIENESVYRTLLQRLFHKSCESKDDGQELPKDSQKLSRPIKTISFYEY
HKTWSGIATSKASEFYKTPLLKDPEFLGQYYKWKKIDLQYPKEWKLKYAATKARFSRETR
MHGHVSPSTKRMHRLPTTIDDAYPESQTNSDVTDSNEKEAGWKSEASSFNSDTEEDWEEE
VDDLVAWTNTLNTEALEEQA
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaaccgcagagttttcctcttgctggaaaaacacttccaagagttcagagagaacaat
tatacgggtattactgcctttccaacgagtgaagacatgatggaatgggaggctgaaatt
gaaggtcttcaggattcaatgtggcaaggactcatctttgagctgacaatagattttacg
ccagagtacaactttgtccctccagtggtgaaatttagaacaattccttttcatccaaat
gtagacccctatactggtcaaccatgtatagattttttggacaaccctgagaagtggaat
acaagctacacgttgagcagcatcttactcactctacaggttatgctgtctaatccaggg
ctagaacagccagtgaatttggaagcagcccaaatgctgattgaaaatgaatctgtatac
agaacactacttcaaagacttttccacaagtcatgcgaatcaaaagatgatggccaggag
ttacctaaagactctcagaagcttagcagaccaattaagacaatctcattttatgaatac
cacaagacatggtctggaatagctacatcaaaggcctcagaattctacaaaactccattg
cttaaagatccagagttccttggacagtattataaatggaagaaaatagatctacaatat
cctaaagaatggaaattaaagtatgctgctaccaaggctcggttttctagggaaactaga
atgcatggccatgtcagtccctcaaccaaaagaatgcatcgcctcccaactacaatagac
gacgcttatcctgagtcacaaaccaacagcgatgtcacagattccaatgaaaaagaggcg
gggtggaagagcgaagcttcctcgtttaatagcgacacggaggaggactgggaagaggag
gtggacgatctggtggcctggaccaacactctcaacacagaggctttagaagagcaagcc
tag

DBGET integrated database retrieval system