KEGG   Oryctolagus cuniculus (rabbit): 100356958
Entry
100356958         CDS       T03373                                 
Symbol
NTN4
Name
(RefSeq) netrin 4
  KO
K06845  netrin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100356958 (NTN4)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF NTR F5_F8_type_C BNR_6
Other DBs
NCBI-GeneID: 100356958
NCBI-ProteinID: XP_002711255
Ensembl: ENSOCUG00000015665
UniProt: G1T9Y0
LinkDB
Position
4:complement(74877411..75006130)
AA seq 625 aa
MGSCAQRLLLLWVAAGLSGVARVSSRCEKACNPRMGNLALGRKLWSDTTCGQNATELYCF
YSENADLTCRPPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEA
EFYFTHLIMVFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGALCTS
RYSSPFPCTGGEVIFRALSPPYDAENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNT
KPQHFTHYAIYDFIVKGSCFCNGHADQCVPVDGFRPVKAPGAFHVVHGKCMCKHNTAGSH
CQQCAPLYNDRPWEAADGRTGAPKECRTCKCNGHAEACHFDINVWEASGNRSGGVCANCQ
HNTEGQHCQRCKPGFYRDLRRPFSAPDACKVCSCHPVGSAVLPFSSVTFCDPSNGDCPCK
PGVAGPHCDRCMVGYWGFGDYGCRPCDCAGSCDPLTGDCISSNTDVDWYHEMPDFHSTHN
KSEPTWEWEDEQGFSALRHSGKCECKEQVLGNPKAFCGMKYSYVLKIKILSAHDKGSHAE
VNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKLVVN
MKSFVQHWKPSLGRKVMDILKRECK
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggggagctgcgcgcagcggctgctgctgctctgggtggcggcaggactgagtggagta
gccagagtgagctcccgctgtgaaaaagcctgcaaccctcggatgggaaacttggctttg
gggagaaaactctggtccgacaccacctgtggccagaacgccaccgaactgtactgcttc
tacagtgagaacgccgatctcacttgtcggccgcccaaatgtgacaagtgcaatgctgcc
caccctcacctggctcacctgccgtcggccatggcagactcgtccttccggtttccacgc
acgtggtggcagtcggcggaggatgtgcacagggaaaagatccagctggacctggaggct
gaattctacttcacacacctgattatggtgttcaagtccccccggccagcagccatggtg
ctggatcggtcccaggactttgggaagacctggaagccttacaaatactttgcaaccaac
tgctcggctacatttggcctggaagatgatgtggtcaagaagggagctctctgcacttct
agatactccagccctttcccgtgcactggaggagaggttattttcagagcgctgtcaccg
ccctacgatgccgagaacccttacagcgccaaagttcaggagcagctgaagatcaccaac
ctccgtgtgcagctgctcaagagacagtcttgtccctgtcagaggaatgacctgaacaca
aagccgcagcatttcacacactatgccatctacgatttcattgtcaagggcagctgcttc
tgcaacggccatgctgatcagtgtgtacctgttgacggcttcagacctgtcaaggccccg
ggagcattccacgtggtccatgggaagtgtatgtgtaagcacaacacagcaggcagccac
tgccagcagtgtgcaccgttatacaatgaccggccctgggaggcagctgatggcagaaca
ggggctcctaaggagtgcagaacatgcaagtgcaacgggcatgctgaggcctgccacttc
gacattaacgtgtgggaggcgtcagggaaccggagcggtggggtctgcgccaactgtcag
cacaacacggaaggccagcactgccagcgctgcaagcccggcttctaccgcgacctccgg
agacccttctctgctccggatgcttgcaaagtgtgttcctgccatccggttggatctgct
gtccttcctttcagctccgtgaccttctgtgaccccagcaatggggactgcccgtgcaag
cctggggtggcagggccacattgtgacaggtgcatggtgggatactggggcttcggagac
tatggctgcagaccctgtgactgtgccgggagctgtgaccctctcacgggagactgcatt
agcagcaacacagacgtagactggtatcatgaaatgcctgacttccactccacgcacaat
aagagcgaaccaacctgggaatgggaggatgagcaaggattttcagcacttcgacactca
ggtaaatgtgaatgtaaggaacaggtgttaggaaaccccaaggcattctgcggaatgaaa
tactcatatgtgctcaaaataaagattttatcagctcacgataaaggttctcatgctgag
gtcaatgtgaagattaaaaaagtcttaaaatctaccaaactgaagattttacgaggaaag
cgaacgttgtatccggaatcgtggactaaccgaggctgcacctgccccatcctcaatcct
ggtttggagtatcttgtagccggacacgaagatgtaagaacaggcaagttagttgtgaat
atgaaaagtttcgtccagcactggaaaccgtcgcttggaagaaaagtgatggatatttta
aaaagagagtgcaagtag

DBGET integrated database retrieval system