KEGG   Oryctolagus cuniculus (rabbit): 100357061
Entry
100357061         CDS       T03373                                 
Symbol
ACVR1C
Name
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100357061 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357061 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100357061 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100357061 (ACVR1C)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100357061 (ACVR1C)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100357061 (ACVR1C)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 100357061
NCBI-ProteinID: XP_008256823
Ensembl: ENSOCUG00000009208
UniProt: G1SWR9
LinkDB
Position
7:complement(96333043..96439907)
AA seq 493 aa
MTPALLSALRQALLLLAAAAELSAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELTVVIIV
PVCLLSIAAMLTVWACQGRQCTYRRKKRQNVEEPLSECNLVNAGKTLKDLIYDVTASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD
MVPSDPSIEEMRKVVCDQNLRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK
TISQLCVKEDCKA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaccccggcgctcctctctgcgctccgccaggctctcctgctgctcgccgcggccgca
gagctctcggcaggattgaagtgtgtgtgtcttttgtgtgactcttcaaactttacctgc
caaacagaaggagcatgttgggcatcagtcatgctaaccaatggaaaagaacaggtgatc
aagtcctgtgtatccctcccagaattaaatgctcaagtcttctgccatagttccaacaat
gttaccaaaactgagtgctgcttcacagatttttgcaacaatataacactgcaccttcca
acagcatcaccaaatgcccccaaacttggacccatggagttgactgttgttattattgtg
cctgtttgcctgctgtccatagctgccatgctgacagtatgggcgtgccaaggacgacag
tgcacctacagaaggaaaaagagacagaatgtggaggaaccactatctgagtgcaatctg
gtaaatgctggcaaaaccctcaaagatctgatttatgatgtgactgcctctggatctggc
tctggtcttcctctgttggttcaaagaacaattgcgaggacaattgtacttcaggaaatt
gtgggaaaaggtagatttggtgaggtgtggcatggaagatggtgcggggaggatgtggcc
gtcaagatattctcctccagggatgaaagatcttggtttcgtgaggcagaaatttaccag
actgttatgctgcgacatgaaaacatccttggcttcatcgctgctgacaacaaagataat
ggaacttggactcaactttggcttgtatctgaatatcatgaacaaggctccttatatgat
tatttgaatagaaacatagtgacagtggctggaatgataaaactggcactttcaatagct
agtggtctggctcacctccatatggagattgttggtacacaaggtaaacctgctattgct
catagagacataaaatcaaagaatatcttagtgaaaaaatgcgaaacttgtgccatagca
gacttggggttggctgtgaagcatgattcaatcctgaacactatagacattcctcagaat
cctaaagtgggaaccaaaaggtatatggctcctgaaatgcttgatgatacaatgaatgtg
aatatctttgagtccttcaaacgagctgacatctattctgttggtctggtttactgggaa
atagcccggaggtgttcagttggaggaattgtggaggagtaccagttgccttattatgat
atggtgccttcagatccctcaatagaggaaatgaggaaggttgtttgtgaccagaatctc
cgaccaagtatcccaaaccagtggcaaagctgtgaagcactccgagtcatggggagaata
atgcgtgagtgctggtatgccaatggggcagcccgcctgactgccctccgtattaagaag
accatctctcaactttgtgtcaaagaagactgcaaagcctaa

DBGET integrated database retrieval system