KEGG   Oryctolagus cuniculus (rabbit): 100357079
Entry
100357079         CDS       T03373                                 
Symbol
THPO
Name
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357079 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357079 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100357079 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357079 (THPO)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100357079 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100357079
NCBI-ProteinID: XP_008264812
Ensembl: ENSOCUG00000007080
LinkDB
Position
14:81337620..81347509
AA seq 354 aa
MAPGRTQGRGPTQGATPARPAGQNGADCPAPPACDPRLLNKLLRDAHVLHGRLSQCPDVN
PLSTPVLLPAVDFSLGEWKTQTEQTKAQDILGAATLLLEAVMAARRQLEPTCLSSLLGQL
SGQVRLLLGALQGLLGTQLPPQSRTTAHKDPSAIFMSFQQLLRGKVRFLLLVAGPTLCVR
RAPPTAAVPGSTPLFLTPNKLPNRTSGSLETSSRVTARTTGAGLLNRLRGLRAKIPGLLN
QTLDRVPGHPNRTHGPLGGTHGLSPGPSASTLGASVIPPETSDAGSLPPSFQLGFSPSPT
HPPPPWYTLFSPAPASPSHLVQLQPLRPDHPATTANPGSPVPAAAHPQNLVPGG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccccaggaaggactcaggggagaggccccactcagggagccactccagccagaccc
gctggccagaatggtgctgactgcccagctcctcctgcctgtgacccccgactcctaaat
aaactgcttcgtgacgcccatgtcctccacggcagactgagccagtgcccagacgttaac
cctttatccacacctgtcctgctgcctgctgtagactttagcttgggagaatggaagacc
cagacggagcagaccaaggcccaggacattctgggagcagcgacccttctgctggaggca
gtgatggcagctcggcgacagctggaacccacctgcctctcctccctgctgggacagctt
tcggggcaggtccgcctcctccttggggccctgcagggcctacttggaacccagcttcct
ccacagagcaggaccacagcacacaaggatcccagtgccatcttcatgagcttccagcag
ctgctccgaggaaaggtgcgcttcctgctgctcgtagcagggcccacgctgtgtgtcagg
cgggccccacccactgccgctgtcccaggcagcacccctctattcctcacaccaaacaag
ctcccaaacaggacttccggatcgctggagaccagctccagggtcacagccagaactact
ggcgctggacttctgaacaggctgcggggactcagggccaagattcctggtctgctaaac
caaaccctggaccgagtccctggacacccgaacaggacacacggacccctgggtggaact
cacggactctctcctgggccctcagccagcaccctgggagcctcggtcattcccccagag
acttcggacgcaggttccttgccacccagcttccagctgggattctctccttccccaacc
catcctcctcctccatggtacacactcttctctcctgccccagcctcacccagccacctg
gtccagctccagcccctgcgtcctgaccatccggctaccacagccaaccctggcagtcct
gtgccggctgcagcccaccctcagaatctggtgccgggagggtga

DBGET integrated database retrieval system