Oryctolagus cuniculus (rabbit): 100357194 Help Entry 100357194         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100357194    04151 PI3K-Akt signaling pathway     100357194   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100357194  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100357194  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100357194    04621 NOD-like receptor signaling pathway     100357194    04622 RIG-I-like receptor signaling pathway     100357194    04623 Cytosolic DNA-sensing pathway     100357194    04650 Natural killer cell mediated cytotoxicity     100357194  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357194   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100357194    05161 Hepatitis B     100357194    05160 Hepatitis C     100357194    05171 Coronavirus disease - COVID-19     100357194    05164 Influenza A     100357194    05162 Measles     100357194    05168 Herpes simplex virus 1 infection     100357194    05163 Human cytomegalovirus infection     100357194    05167 Kaposi sarcoma-associated herpesvirus infection     100357194    05169 Epstein-Barr virus infection     100357194    05165 Human papillomavirus infection     100357194   09171 Infectious disease: bacterial    05152 Tuberculosis     100357194   09163 Immune disease    05320 Autoimmune thyroid disease     100357194   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357194   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100357194  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100357194 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100357194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100357194 NCBI-ProteinID:  XP_002708115 Ensembl:  ENSOCUG00000022525 UniProt:  G1TMS3 LinkDB All DBs Position 1:46634436..46635005 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI WQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcctttctcttcactgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc tggcaagaaagaatttggagcaaggaatga

DBGET integrated database retrieval system