KEGG   Oryctolagus cuniculus (rabbit): 100357263
Entry
100357263         CDS       T03373                                 
Symbol
FHL1
Name
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357263 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100357263 (FHL1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 LIM domain-containing proteins
  FHL family proteins
   100357263 (FHL1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 100357263
NCBI-ProteinID: XP_002720369
Ensembl: ENSOCUG00000006034
LinkDB
Position
X:110697912..110742423
AA seq 296 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCAECR
KPIGADSKEVHYKNRYWHDTCFRCAKCLRSLASETFVAKDNKIYCNKCATREDSPKCKGC
FKAIVAGDQNVEYKGTIWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGFGKGASVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcttcccatcgacactcaggtccctcgagctacaaggtaggcaccatggctgagaag
tttgactgccactactgcagggaccctttgcaggggaagaagtacgtgcagaaggatggc
caccactgctgcctgaagtgctttgacaagttctgtgccaacacctgtgcagaatgccgc
aagcccattggtgcggactccaaggaggtgcactataagaaccgatactggcacgacacc
tgcttccgctgtgccaagtgccttcgctccttggctagtgagacctttgtggccaaggac
aacaagatttactgcaacaagtgcgccactcgtgaggactcccccaagtgcaagggctgt
ttcaaggccatcgtggcaggagatcaaaacgtggagtacaaggggaccatctggcacaag
gactgcttcacctgcagcaactgcaagcaagtcatcgggactggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccacgagaccaagtttgcgaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggtttggtaaaggcgccagtgtggtggcctatgaaggacaatcc
tggcacgactactgcttccactgcaaaaaatgctccgtgaatctggccaacaagcgcttt
gtctttcaccaggagcaagtgtactgccccgactgtgccaaaaagctgtaa

DBGET integrated database retrieval system