Oryctolagus cuniculus (rabbit): 100357341 Help Entry 100357341         CDS       T03373                                  Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04064   NF-kappa B signaling pathway ocu04210   Apoptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04931   Insulin resistance ocu04936   Alcoholic liver disease ocu05132   Salmonella infection ocu05134   Legionellosis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05215   Prostate cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100357341    04668 TNF signaling pathway     100357341    04024 cAMP signaling pathway     100357341  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100357341    04660 T cell receptor signaling pathway     100357341    04658 Th1 and Th2 cell differentiation     100357341    04659 Th17 cell differentiation     100357341    04657 IL-17 signaling pathway     100357341    04662 B cell receptor signaling pathway     100357341    04062 Chemokine signaling pathway     100357341   09152 Endocrine system    04926 Relaxin signaling pathway     100357341   09156 Nervous system    04722 Neurotrophin signaling pathway     100357341   09158 Development and regeneration    04380 Osteoclast differentiation     100357341  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357341    05208 Chemical carcinogenesis - reactive oxygen species     100357341    05203 Viral carcinogenesis     100357341    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100357341   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100357341    05215 Prostate cancer     100357341    05222 Small cell lung cancer     100357341   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100357341    05170 Human immunodeficiency virus 1 infection     100357341    05161 Hepatitis B     100357341    05160 Hepatitis C     100357341    05171 Coronavirus disease - COVID-19     100357341    05164 Influenza A     100357341    05162 Measles     100357341    05163 Human cytomegalovirus infection     100357341    05167 Kaposi sarcoma-associated herpesvirus infection     100357341    05169 Epstein-Barr virus infection     100357341   09171 Infectious disease: bacterial    05135 Yersinia infection     100357341    05134 Legionellosis     100357341   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100357341    05140 Leishmaniasis     100357341    05142 Chagas disease     100357341   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357341   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100357341    04931 Insulin resistance     100357341  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ocu03000]     100357341    04131 Membrane trafficking [BR:ocu04131]     100357341 Transcription factors [BR:ocu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100357341 Membrane trafficking [BR:ocu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100357341 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank Ank_2 Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  100357341 NCBI-ProteinID:  XP_002718188 Ensembl:  ENSOCUG00000015642 UniProt:  G1T9W2 LinkDB All DBs Position 17:complement(55971703..55974838) Genome browser AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RAAEPWRQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TSQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLKQTCTAQHLHSILQAIN YNGHTCLHLASIHGYLGIVELLVSWGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQRLPESEDEESCDTESDGTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccggccgagcacgctcaggactgggccatggaggggccccgggacgcgctg aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaggcgccg cgcgccgccgagccctggaggcagcagctcacggaggacggagactcgttcctccacttg gccatcatccatgaagagaaggcattgaccatggaagtgattcgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccgctccacttggctgtcatc actagccagccagaaattgctgaggcactgctggaagctggctgtgatcctgagctgcgg gactttcgaggaaacactccgctgcaccttgcctgcgagcagggctgcctggccagcgtg ggcgtcctcaagcagacctgcacggcccagcacctgcactccattctgcaggccatcaac tacaacggccacacgtgtctgcacctggcttccatccacggctacctgggcatcgtggag ctgttggtgtcctggggtgctgatgtcaacgcccaggaaccctgcaatgggcgcacggcc ctccacctcgccgtggacctgcagaatccggacctggtgtcgctcttgttgaagtgcggg gccgatgtcaaccgggtcacctaccagggctactccccgtaccagctcacatggggccgc cccagcacccggatccagcagcagctgggccagctgaccttggagaacctccagaggttg cccgagagtgaggacgaggagagctgtgacacggagtcggacggcacggaggatgagctg ccctatgatgactgcgtgttcggaggccagcgcctgaccttgtga

DBGET integrated database retrieval system