KEGG   Oryctolagus cuniculus (rabbit): 100357348
Entry
100357348         CDS       T03373                                 
Symbol
ANAPC7
Name
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357348 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100357348 (ANAPC7)
   04114 Oocyte meiosis
    100357348 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100357348 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357348 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357348 (ANAPC7)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100357348 (ANAPC7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100357348 (ANAPC7)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100357348 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_1 TPR_14 TPR_16 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_17 TPR_21 TPR_10 BTAD
Other DBs
NCBI-GeneID: 100357348
NCBI-ProteinID: XP_008270431
Ensembl: ENSOCUG00000014301
LinkDB
Position
21:complement(6700003..6729519)
AA seq 565 aa
MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPSQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAINTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVESLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgaatgtgatagaccacgtgcgggacatggcagccgcggggctgcactccaatgtgcgg
cttctcagcagcttgttacttacaatgagtaataacaacccggagttgttctccccgtct
cagaagtaccagctcttggtgtatcatgctgactctctgtttcacgataaggaataccgg
aatgctgtcagtaagtataccatggctttacagcaaaagaaagcccttagtaaaacttca
aaagtgagaccttcaactggaaattctgcgtctactccacaaagtcagtgtcttccttct
gaaattgaggtgaaatacaaaatggctgaatgttatacaatgctaaaacaagataaagat
gccattgccatacttgatgggatcccttcaagacaaagaactcccaaaataaacatgatg
ctggcaaatttgtacaagaaggctggtcaggagcgcccttcagtcaccagctataaggag
gtgctgcggcagtgccctttagccctggatgccattctaggcttgctgtccctttctgta
aaaggtgcagaggtggcatcaatgacaatgaacgtaatccagacggtacctaacttggac
tggctctcagtgtggatcaaagcctatgcttttgtgcataccggcgacaactcaagagca
atcaataccatctgttcactagagaagaagtccttactgcgagataacgtggacctcctg
ggaagcttagcagatctgtacttcagagctggagacaataaaaactccgtccttaaattt
gagcaggcacagatgttggatccttatctgataaaaggaatggatgtgtacggctacctc
ctggcacgggaagggcgactggaggatgtggagagccttggctgccgccttttcaatatt
tctgatcagcatgcagaaccctgggtggtctctgggtgtcatagtttctatagcaaacgg
tattcccgggccctgtatttaggagccaaggctattcagctgaacagtaacagcgttcaa
gcattgctcctgaagggagccgcactgaggaacatgggcagagtccaagaagcaataatc
cattttcgggaggccatacggcttgcaccttgtcgcttagattgttatgaaggtctcatc
gagtgttacttggcctccaacagtattcgtgaagcaatggtaatggctaacaacgtttac
aaaactcttggtgcaaatgcacagacccttacccttttagccactgtttgtcttgaagac
ccggtgacacaggagaaagccaaaaccttgttagataaagccctgacccaaaggccagat
tacattaaggctgtggtgaaaaaagcagaactgcttagcagagaacagaaatatgaagat
ggaattgcgttactcagaaacgcactggctaatcagagtgactgtgtcctgcatcggatc
ctaggagatttccttgtagctgtcaatgagtatcaggaggcaatggaccagtatagtata
gcactaagtttggaccccaatgaccagaagtctctagaggggatgcagaagatggagaag
gaggagagtcccacggatgccactcaggaggaggatgtggacgacatggaagggagtggg
gaagaaggggacctggagggcagcgacagtgaggcggcccagtgggctgaccaggagcag
tggttcggcatgcagtga

DBGET integrated database retrieval system