KEGG   Oryctolagus cuniculus (rabbit): 100357502
Entry
100357502         CDS       T03373                                 
Symbol
FZR1
Name
(RefSeq) fizzy-related protein homolog
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357502 (FZR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100357502 (FZR1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100357502 (FZR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357502 (FZR1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     100357502 (FZR1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Nup160 Ge1_WD40
Other DBs
NCBI-GeneID: 100357502
NCBI-ProteinID: XP_017202164
LinkDB
Position
14:62977040..62978575
AA seq 496 aa
SRPPPSGQLGPAGRAPPARDQDYERRLLRQIVVQKENTVPCVSELRRTLTPANSPVSSPS
KHGDRFIPSRAGANGSVNFHRINENEKSPSQNRKAKDAKDGLAYSALLKNELLGAGIEKV
QDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDTKDVSPYSLSPVSTKSQKRLRSPRKP
ARKISKIPFKVLDAPELQDDFYLNLVDWSXLLSVGLGTCVYLWSACTSQVSRLCDLSVEG
DSVTSVGWSERGNLVAVGTHKGFVQIWDAAEDKKLLVLEGHMARVGAMAWNAEQLSSGSL
DRVILQRDIRSPPLQAERRLQGHRQEVCGLKWSTDHQLLXLVWNHSSLAPVQQYTEHLAA
AKAISWSPHQHGLLASGGGTADRCIRFWNALTGQLLQCIDTGSQVCNLAWSKHASELVST
HGYSQNQILVWKYPSLTQVAKLTGHLYRVLYLAMSPDGEALITGAGDETLRFWNVFSKTR
STKESVSVLNLFNRIR
NT seq 1491 nt   +upstreamnt  +downstreamnt
tctcgcccccctccctcaggtcagctggggcccgcgggccgcgccccgcccgccagggac
caagactacgagcggcgcctgctgcggcagatcgtcgtgcagaaagagaacacggtgccc
tgtgtctcggagctgcggcggacgctgaccccggccaactccccggtgtcctctcccagc
aagcacggcgaccgcttcatcccctcgcgggcgggggccaacgggagcgtgaacttccac
cggatcaacgagaatgagaagtctcccagccaaaaccgcaaagccaaggatgccaaagac
ggcctggcctactctgcgctgctcaagaacgagctgctgggcgccggcatcgagaaggtg
caggacccgcagacggaggaccgcaggctgcagccgtccacgcccgagaagaaggggctg
ttcacgtattccctgagcaccaagcgctcgagccctgacgacaccaaagacgtgtcgccc
tactccctgtcccccgtcagcaccaagagccagaagcggctccggtccccgcggaagccc
gcgcgcaagatctccaagattccgttcaaggtgctggacgcgcccgagctgcaggacgac
ttctacctgaacctggtggactggtcgnacttgctgagcgtggggctgggcacgtgcgtg
tacctgtggagcgcctgtaccagccaggtgtcgcggctctgcgacctgtcggtggagggc
gactcggtcacctccgtgggctggtccgagcgggggaacctggtggccgtgggcacgcac
aagggcttcgtgcagatctgggacgcggctgaggacaagaagctgttggtgctggagggg
cacatggcgcgcgtgggcgcgatggcctggaacgccgagcagctgtcgtcgggcagccta
gaccgcgtgatcctgcagcgggacatccgcagccccccgctgcaggctgagcggcggctg
cagggccaccggcaggaggtgtgcggcctcaagtggtccacggaccaccagctgctgngc
ctcgtctggaaccactcgagcctggcgcccgtgcagcagtacaccgagcacctggctgcc
gcgaaagccatctcctggtcgccgcaccagcacgggctgctggcgtcgggcggcggcacg
gccgaccgctgcatccgcttctggaacgcgctcacgggccagctgctgcagtgcatcgac
acgggctcccaggtgtgcaacctggcctggtccaagcacgccagcgagctggtgagcacg
cacggctactcccagaaccagatcctcgtctggaagtacccgtcgctgacccaggtggcc
aagctcaccgggcacttgtaccgcgtcctctacctggccatgtcgcccgacggggaggcc
ctcatcactggggccggggacgagaccctgcgcttctggaacgtctttagcaaaacgcgg
tccaccaaggagtccgtgtcggtcttgaacctcttcaacaggatccggtaa

DBGET integrated database retrieval system