KEGG   Oryctolagus cuniculus (rabbit): 100357800
Entry
100357800         CDS       T03373                                 
Symbol
RELT
Name
(RefSeq) RELT tumor necrosis factor receptor
  KO
K05156  tumor necrosis factor receptor superfamily member 19-like
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357800 (RELT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100357800 (RELT)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100357800 (RELT)
SSDB
Motif
Pfam: RELT TNFR_c6
Other DBs
NCBI-GeneID: 100357800
NCBI-ProteinID: XP_008262519
Ensembl: ENSOCUG00000025119
UniProt: G1TSH0
LinkDB
Position
1:complement(143096408..143114059)
AA seq 431 aa
MMKLSLLCRPLSCLILLLPWPLATPASTTPWQCPPGEEPGLDPEQGTLCRSCPPGTFSAS
WGSSPCQPHNRCSFRRRLEAQAGTATQDALCGGCQPGWFGPWEVPRVPCQPCSWAPPGTR
GCDEWRRRTRRGVEVAAGASGAGETRQTGNGTRAGGPEETATQYAVIAIVPVFCLMGLLG
ILVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAA
ALEELLKEHHSKQLVQTSHRLGPRPPPAAPGTPHICPHRHHLHTVQGLASLSGPCCSRCS
QKKWPEVLLSPEAAAAATPAPSLLPNPVRTPKTGAKAGRQGEITILSVGRFRVARIPEQR
TSSGASEVKTITEAGPSGNEPPDSPQPGLQAEQRALLGSGGSHAKWLKAPVETKAEENRY
VVRMSESNLVI
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgatgaagctgagcctgctatgccggcccctgtcctgcctcatcctgctgcttccctgg
cctctggccacaccagcatccactaccccgtggcaatgcccaccgggggaagagcccggc
ctggacccagagcagggcacattgtgcagatcctgcccgccgggcaccttctcagcctca
tggggctccagtccatgccagccccataaccgctgcagctttcgaaggcggctggaggcc
caggcaggcacggcgactcaggatgcgctctgtggaggctgccagcctgggtggtttggg
ccttgggaggtcccccgtgttccatgtcagccgtgctcctgggcccctccgggtactcga
ggctgcgatgaatggaggcggcggacccggcgtggtgtggaggtggctgcaggggccagc
ggtgccggcgagacgcggcagaccgggaacggcacgcgggcgggcggccccgaggagacg
gccacccagtacgcggtgatcgccattgtgcctgtcttctgcctcatggggctgctgggc
atcctggtgtgcaacctgctcaagcggaagggctaccactgcacggctcacaaggaggtc
gggcccggccctggaggtggaggcagcggcatcaatcccgcctaccggaccgaggatgcc
aacgaggacaccattggggtcctggtgcgcctcatcacagaaaagaaagagaatgcggcg
gccctggaggagctgctgaaggagcaccatagcaaacagctggtgcagacaagccacagg
ctcgggcccaggccgccaccagctgcccccggcacgccgcacatctgcccacaccgccac
cacctccacaccgtgcagggcctggcctcgctctctggcccgtgctgctcccgttgtagc
cagaagaagtggccggaggtgctgctgtctcctgaggctgcagccgctgccacacctgcc
cccagcctcctgcccaaccctgttaggacacccaagactggggccaaggcgggccgccag
ggcgagatcaccatcttgtctgtgggcaggttccgggtggctcgaattccggagcagcgg
acgagttcaggggcatctgaggtgaagaccatcacggaggccgggccctcagggaatgag
ccccccgactccccacagcctggcctccaggctgagcagcgggcactgctgggcagtggc
ggaagccatgctaagtggttaaaggccccagtggagaccaaggccgaggagaaccgctat
gtggtccggatgagcgagagcaacctggtgatctga

DBGET integrated database retrieval system