KEGG   Oryctolagus cuniculus (rabbit): 100357809
Entry
100357809         CDS       T03373                                 
Symbol
CHMP3
Name
(RefSeq) charged multivesicular body protein 3
  KO
K12193  charged multivesicular body protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100357809 (CHMP3)
  09143 Cell growth and death
   04217 Necroptosis
    100357809 (CHMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357809 (CHMP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100357809 (CHMP3)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100357809 (CHMP3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100357809 (CHMP3)
SSDB
Motif
Pfam: Snf7 DUF3915
Other DBs
NCBI-GeneID: 100357809
NCBI-ProteinID: XP_008252373
Ensembl: ENSOCUG00000029277
UniProt: G1SZ35
LinkDB
Position
2:99794222..99860680
AA seq 221 aa
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
VVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKA
PSKVTDALPEPELPGAMAASEDEEEEEALEAMQSRLATLRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggggctgtttgggaaaacccaggagaagccgcccaaagaactggtcaatgaatggtca
ttgaagatcagaaaagaaatgagagttgttgataggcaaataagagacatacaaagggaa
gaagaaaaggtgaaacgatctgtgaaggatgccgctaagaagggccagaaggatgtgtgt
gtggttctggccaaggagatgatccgctcaaggaaggccgtgagcaagctctacgcgtcc
aaagcccacatgaactccgtgctcatggggatgaagaaccagctcgcggtcctgcgcgtg
gctggttccctgcagaagagcacagaggtgatgaaggccatgcagagccttgtgaagatc
ccagagatccaggccaccatgagggagctgtccaaagagatgatgaaggctgggatcata
gaagaaatgctggaggacacttttgaaagcatggatgatcaggaagaaatggaagaggcg
gcagagatggaaattgacagaattctgtttgaaatcacagcaggggccttgggcaaagcg
cccagtaaggtgaccgacgccctgccagagcccgagctcccaggagcaatggctgcatct
gaagacgaggaggaggaggaggccctggaggccatgcagtcacgcctggccacactccgc
agctaa

DBGET integrated database retrieval system