KEGG   Oryctolagus cuniculus (rabbit): 100357896
Entry
100357896         CDS       T03373                                 
Symbol
BMP10
Name
(RefSeq) bone morphogenetic protein 10
  KO
K22670  bone morphogenetic protein 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357896 (BMP10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357896 (BMP10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100357896 (BMP10)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide BAG
Other DBs
NCBI-GeneID: 100357896
NCBI-ProteinID: XP_002709871
Ensembl: ENSOCUG00000010221
LinkDB
Position
2:117295688..117306308
AA seq 426 aa
MGSPVLGLCAVFCLVAHSVAGSPIMGLEQSPLEEDMPLFEDVFSEQDGVDFNTLLQSMKD
EFLKTLNLSDIPTQESAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPASF
NGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRLIYDGVDRKITIFEVLDSEGDSEGD
NNGERSLLVLVSGEIYGTNSEWETFDVTDAIRRWQKSSSSTHQLEVHIESRHNEAEDISR
GQLEIDTSAQNKHDPLLVVFSDDQSSDKERKEELNEMIAHEQLLELDSVDGFSRGPGEEA
LLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNY
PLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAV
SECGCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgggttctccggtgctcgggctgtgcgctgtcttctgcctggtggctcactccgtggct
gggagccccatcatgggcctggagcagtcgcctctggaggaagacatgcccctcttcgag
gatgtcttctcggagcaagacggtgtggactttaacacgctgctccagagcatgaaggat
gagtttctcaagacgctgaacctgtccgacattcctacgcaggagtccgccaaggtcgac
ccgcctgagtacatgctggaactttacaacaagttcgccacggatcgcacctccatgccc
tctgccaacatcatcaggagtttcaagaatgaagatctgttctctcaaccagccagtttt
aatggactccgaaaataccctcttctcttcaatgtgtccatccctcaccatgaagaagtc
atcatggctgaactcaggttgtacacactggtgcaaagagatcgcctgatatacgatgga
gtggaccggaaaattaccatttttgaagttctagatagcgaaggagacagcgaaggagac
aacaacggggaaagaagcctgctggttttagtgtcaggggagatctatggaaccaacagt
gagtgggagacttttgatgtcacggatgccatcagacgttggcagaagtcaagttcatcg
acccaccagctggaggtccacattgagagcaggcacaatgaagctgaggacatcagtagg
ggacaattggagatagacaccagtgcccagaataagcatgaccctctgcttgttgtgttt
tctgatgaccaaagcagtgacaaggagcggaaggaggaactgaatgaaatgattgcccat
gagcagcttctcgagctggacagcgtggatggcttttccagggggcctggggaagaggca
ttgctgcagatgaggtcgaacatcatctacgactccactgctcgaatccggaggaacgcc
aaaggcaactactgcaagaggaccccgctctacatcgacttcaaagagattggctgggac
tcctggatcattgctcctcccgggtatgaagcctatgaatgccgcggtgtttgtaactac
cccctggcagagcacctcacacctacaaaacacgcaattatccaggccttggttcacctc
aagaactcccagaaggcttccaaagcttgctgtgtgcccacaaagctcgagcccatctcc
atcctctatttagacaaaggcgttgtcacctacaagttcaaatatgaaggcatggccgtc
tccgaatgtggctgtagatag

DBGET integrated database retrieval system