Oryctolagus cuniculus (rabbit): 100358075 Help Entry 100358075         CDS       T03373                                  Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04630   JAK-STAT signaling pathway ocu04640   Hematopoietic cell lineage ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04672   Intestinal immune network for IgA production ocu05200   Pathways in cancer ocu05310   Asthma ocu05320   Autoimmune thyroid disease ocu05321   Inflammatory bowel disease ocu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100358075   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100358075  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100358075    04660 T cell receptor signaling pathway     100358075    04658 Th1 and Th2 cell differentiation     100358075    04657 IL-17 signaling pathway     100358075    04664 Fc epsilon RI signaling pathway     100358075    04672 Intestinal immune network for IgA production     100358075  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100358075   09163 Immune disease    05310 Asthma     100358075    05320 Autoimmune thyroid disease     100358075    05321 Inflammatory bowel disease     100358075    05330 Allograft rejection     100358075  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100358075    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100358075 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interleukins    100358075 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Cytokines    100358075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  100358075 NCBI-ProteinID:  XP_002710247 Ensembl:  ENSOCUG00000004171 UniProt:  G1SL79 LinkDB All DBs Position 3:complement(15527234..15529406) Genome browser AA seq 134 aa AA seqDB search MRMLLHWTLLALGAAYVCAMATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNH HLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQ EFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcactggaccttgctggctcttggagctgcctatgtttgtgccatg gccacagaaatccgcatgagcacagtggtgaaagagaccctgacactgctctcaacttac cagagtctgctgataggcaatgagactttgatgattcctgttccggtccataaaaatcat cacctatgcatcgaagaaacctttcgaggtgtagacacactgaaggctcagattgtgcaa ggggaggctatggacaatctgttccaaaacttgtatttaataaaaaaatacattgaccta caaaaaaaaaagtgtggtgaagaaaggcggggagttaagcacttcctagactacctgcag gagttccttggtgtgataaacactgagtggacgatggaaagctga

DBGET integrated database retrieval system