KEGG   Oryctolagus cuniculus (rabbit): 100358075
Entry
100358075         CDS       T03373                                 
Symbol
IL5
Name
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358075 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358075 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100358075 (IL5)
   04660 T cell receptor signaling pathway
    100358075 (IL5)
   04658 Th1 and Th2 cell differentiation
    100358075 (IL5)
   04657 IL-17 signaling pathway
    100358075 (IL5)
   04664 Fc epsilon RI signaling pathway
    100358075 (IL5)
   04672 Intestinal immune network for IgA production
    100358075 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358075 (IL5)
  09163 Immune disease
   05310 Asthma
    100358075 (IL5)
   05320 Autoimmune thyroid disease
    100358075 (IL5)
   05321 Inflammatory bowel disease
    100358075 (IL5)
   05330 Allograft rejection
    100358075 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358075 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100358075 (IL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100358075 (IL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100358075 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 100358075
NCBI-ProteinID: XP_002710247
Ensembl: ENSOCUG00000004171
UniProt: G1SL79
LinkDB
Position
3:complement(15573493..15576133)
AA seq 134 aa
MRMLLHWTLLALGAAYVCAMATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNH
HLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQ
EFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcactggaccttgctggctcttggagctgcctatgtttgtgccatg
gccacagaaatccgcatgagcacagtggtgaaagagaccctgacactgctctcaacttac
cagagtctgctgataggcaatgagactttgatgattcctgttccggtccataaaaatcat
cacctatgcatcgaagaaacctttcgaggtgtagacacactgaaggctcagattgtgcaa
ggggaggctatggacaatctgttccaaaacttgtatttaataaaaaaatacattgaccta
caaaaaaaaaagtgtggtgaagaaaggcggggagttaagcacttcctagactacctgcag
gagttccttggtgtgataaacactgagtggacgatggaaagctga

DBGET integrated database retrieval system