KEGG   Oryctolagus cuniculus (rabbit): 100358097
Entry
100358097         CDS       T03373                                 
Symbol
CCR2
Name
(RefSeq) C-C motif chemokine receptor 2
  KO
K04177  C-C chemokine receptor type 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358097 (CCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100358097 (CCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100358097 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100358097 (CCR2)
   04050 Cytokine receptors [BR:ocu04050]
    100358097 (CCR2)
   04090 CD molecules [BR:ocu04090]
    100358097 (CCR2)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100358097 (CCR2)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100358097 (CCR2)
CD molecules [BR:ocu04090]
 Proteins
  100358097 (CCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 100358097
NCBI-ProteinID: XP_002713326
Ensembl: ENSOCUG00000003660
UniProt: G1SK57
LinkDB
Position
9:14542070..14547699
AA seq 369 aa
MHPAPQLTHNMLSTSHSLLTRSDLSSPEEATTVFDYDSEPCHKTDVKQVAAQLLPPLYSL
VFVCGFVGNLLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTLPLWAHYAAAEWVFGSA
MCKLSTGMYHMGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWVAAIFA
SVPGILFTRFQEEDSRYTCGPDFPLSWKNFHTIMRNILSLVLPLLVMVVCYSGILKTLLR
CRNEKRRHRAVRLIFAIMVVYFLFWAPYNVVLLLNTFQEFFGLNNCESSGQLDRAMQVTE
TLGMTHCCINPVVYAFVGEKFRSYLSAFFRKHVAKRLCKQCPVFYREAADRVSSTYTHST
GDQEISAGL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgcacccggctccccagctcacccacaacatgctgtccacgtctcactccctgctgacg
agaagcgacctcagcagccccgaggaagccaccaccgtgttcgactacgacagcgagccc
tgtcacaagaccgacgtgaagcaggtggcagcccagctcctgcccccgctgtactcgctc
gtgttcgtctgcggcttcgtgggcaacctgctggtcgtcctcatcctgatcaactgcaag
aagctgaagagcatgactgacatctacctgctcaacctggccatctccgacctgctcttc
ctgctcaccctcccgctgtgggctcactacgccgctgccgagtgggtcttcggaagtgct
atgtgcaagctgtccacggggatgtatcacatgggctatttcggtggaatcttcttcatc
atcctcctgaccatcgaccggtacctggctatcgtccacgccgtgtttgccttaaaagcc
aggacggtcacctttggggtggtgacaagcggggtcacctgggtggcggccatatttgcc
tcggtcccgggaatcttgtttaccaggttccaagaagaagattctcgttacacctgtggc
cccgattttccactcagctggaagaatttccacaccatcatgaggaacatcttgagcctg
gtcctgccgctgctggtcatggtcgtgtgctactcggggatcctgaaaaccctgctgcgg
tgtcggaacgagaagaggaggcacagggctgtgcggctcatcttcgccatcatggtggtt
tacttcctcttctgggcaccctacaacgtcgtcctcctcctgaacaccttccaggagttc
ttcggcctgaataactgtgaaagcagcggtcagctggaccgagccatgcaggtgacggag
acgctgggcatgacacactgctgcatcaaccccgtggtctacgccttcgtcggggagaag
ttccggagctacctctccgcatttttccggaagcacgtcgccaaacgcctctgcaaacaa
tgtccggttttctacagggaggcagcagatcgagtgagttcaacgtacacccactccact
ggggaccaggaaatctctgctggtctgtag

DBGET integrated database retrieval system