KEGG   Oryctolagus cuniculus (rabbit): 100358123
Entry
100358123         CDS       T03373                                 
Symbol
VPS29
Name
(RefSeq) VPS29, retromer complex component
  KO
K18467  vacuolar protein sorting-associated protein 29
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358123 (VPS29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358123 (VPS29)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    100358123 (VPS29)
 Protein recycling
  Others
   Retriever complex
    100358123 (VPS29)
SSDB
Motif
Pfam: Metallophos_2 Metallophos
Other DBs
NCBI-GeneID: 100358123
NCBI-ProteinID: XP_008270444
Ensembl: ENSOCUG00000011924
UniProt: G1T286
LinkDB
Position
21:complement(6787690..6796348)
AA seq 186 aa
MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDV
HIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHT
HKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVER
IEYKKS
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctgggcacagattggtgttggtgctaggagatctgcacatcccacaccggtgcaac
agtttgccagctaaattcaaaaaactcctggtgccaggaaagatccagcatattctctgc
actgggaacctttgcaccaaagaaagctatgattacctcaagaccctggctggcgacgtc
cacatcgtgagaggggacttcgacgagaatctgaattatccagaacagaaagttgtgact
gttggacagttcaaaattggtttgatccatggacatcaggttattccgtggggagacatg
gccagcttggctctgttgcagcggcagtttgatgtggacattcttatctcaggacacaca
cacaaatttgaagcatttgagcatgaaaataaattctatattaacccaggttctgccact
ggggcatataatgccttggaaacaaacattattccttcatttgtattgatggatatccag
gcttctacagtggtcacttatgtgtatcaactaattggagatgacgtgaaagtagaacga
attgaatacaaaaaatcctaa

DBGET integrated database retrieval system