KEGG   Oryctolagus cuniculus (rabbit): 100358285
Entry
100358285         CDS       T03373                                 
Symbol
SPG21
Name
(RefSeq) spastic paraplegia 21 (autosomal recessive, Mast syndrome)
  KO
K19367  maspardin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358285 (SPG21)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Other DBs
NCBI-GeneID: 100358285
NCBI-ProteinID: XP_002718115
Ensembl: ENSOCUG00000016136
UniProt: A0A5F9CNN5
LinkDB
Position
17:7297357..7318996
AA seq 281 aa
MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFF
RQILALTGWGYRVIAVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTW
TANSFWLMPAFMLKKIVLGNFSSGPVDPMMANAIDFMVDRLESLGQSELASRLTLNCQNS
YVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNL
YVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGNLSLSQEEQ
NT seq 846 nt   +upstreamnt  +downstreamnt
atgggagagattaaagtctctcctgattataactggtttagaagtacagttccccttaaa
aagattatcgtggacgatgacgacagtaagatctggtcgctgtatgatgcaggccctcgg
agtatcaggtgtcctctcatattcctcccccctgtcagcgggactgcagatgtgttcttc
cggcaaattttggctttgaccggatggggttaccgggtaatagctgttcatctttttggg
gcttctttgggaggctttttggcccagaaatttgctgaatatactcacaagtctcccaga
gtccattccctcatcctctgcaatgccttcagtgacacgtctatctttaaccagacttgg
accgcaaacagcttttggctgatgccagcatttatgctcaaaaaaatagttcttggaaac
ttttcttctggcccagtggaccctatgatggccaacgccattgacttcatggtggacagg
ctggaaagtttgggtcagagtgaactggcttccaggcttaccctgaattgtcagaattct
tacgtggaacctcataaaattcgggacatccccgtgaccatcatggatgtgtttgatcag
agtgcactttcaaccgaagcgaaggaggaaatgtacaaactgtatcccaacgcccggaga
gctcaccttaaaacaggaggcaatttcccatacctgtgcagaagtgcagaggtgaacctt
tatgtacagatacacttgctgcagttccacggaaccaagtacgcggccatcgacccgtcc
atggtcagtgccgaggagctcgaggtgcagaagggcaacctcagcctcagccaggaggag
cagtag

DBGET integrated database retrieval system