KEGG   Oryctolagus cuniculus (rabbit): 100358301
Entry
100358301         CDS       T03373                                 
Symbol
NTNG2
Name
(RefSeq) netrin G2
  KO
K16359  netrin-G2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100358301 (NTNG2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100358301 (NTNG2)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF
Other DBs
NCBI-GeneID: 100358301
NCBI-ProteinID: XP_017193429
LinkDB
Position
Un
AA seq 532 aa
MLYLLALLLHCLPLACGSYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMLDKEDEGLVTYWQSITWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSVRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSAWGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHD
RCNETGFCECREGAAGPKCDDCLPTHYWRQGCFRECPNVCDYDQLLCRNGGNCLQNQRCA
CPRVYTGVRCEQPRCDPADGGLDCGRAPGAAPRPATLLGCLLLLGLAARLGC
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgctgtacctgctggccctcctcctgcactgcctcccgctggcctgtgggagctatgac
atctgcaaatcctgggtgaccacggatgagggccccacctgggagttctacgcctgccag
cccaaggtgatgcggctgaaggattacgtcaaggtgaaggtagagccctcgggcatcacg
tgtggagaccccccggagaggttctgctcccacgagaacccctacctgtgcagcaacgaa
tgtgacgcctccaacccggacctggcccacccgccccggctcatgctggacaaggaggac
gaggggctggtcacctactggcagagcatcacgtggagccgctaccccagcccgctggag
gccaacatcaccctgtcctggaacaagagcgtggagctcacggacgacgtggtggtgacc
ttcgagtacggccggcccacggtcatggtgctggagaagtcgctggacaatgggcgcacg
tggcagccctaccagttctacgcggaggactgcatggaggccttcggcatgtcggcccgg
cgcgcccgcgacatgtcctcctccagcgcgcaccgggtgctctgcacggaggagtactcg
cgctgggcgggctccaagaaggagaagcacgtgcgcttcgaggtgcgggaccgcttcgcc
atcttcgcgggccccgacctgcgcaacatggacaacctctacacgcgcctggagagcgcc
aagggcctcaaggagttcttcacgctcacggatctgcgcatgcggctgctgcgcccggcg
ctgggcggcacctacgtgcagcgcgagaacctctacaagtacttctatgccatctccaac
atcgaggtcattggcaggtgcaagtgcaacctgcacgcaaacctgtgctctgtgcgcgaa
ggcagcctgcagtgtgagtgtgagcacaacaccacgggccccgactgcggcaagtgcaag
aagaacttccgcacgcgctcctggcgggccggctcctacctgccgctgcctcacggctcc
cccaacgcctgtgccgctgccggctctgcctggggcaactgtgagtgctacggccactcc
aaccgctgcagctacatcgacttcctgaacgtggtgacttgtgtcagctgcaaacacaac
acgcgcggccagcactgccagcactgccgcctgggctactaccgcaacggctcggccgag
ctggacgacgagaacgtgtgcatcgagtgcaactgtaaccagatcggctccgtgcacgac
cgctgcaacgagaccggcttctgtgagtgccgcgagggcgcggcggggcccaagtgtgac
gactgcctccccacgcactactggcgccagggctgcttccgtgagtgtccaaacgtgtgc
gactatgaccagctgctctgccggaacggcggaaattgcttgcagaaccagcgctgcgcc
tgcccccgcgtctacaccggagtgcgctgcgagcagccgcgctgcgacccggccgacggc
ggcctggactgcggccgagcgcccggcgccgccccgcgccccgccaccctgctcggctgc
ctgctgctgctgggcctggccgcccgcctgggctgctga

DBGET integrated database retrieval system