KEGG   Oryctolagus cuniculus (rabbit): 100358332
Entry
100358332         CDS       T03373                                 
Symbol
EDAR
Name
(RefSeq) ectodysplasin A receptor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100358332 (EDAR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358332 (EDAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100358332 (EDAR)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100358332 (EDAR)
SSDB
Motif
Pfam: KI67R
Other DBs
NCBI-GeneID: 100358332
NCBI-ProteinID: XP_002710031
Ensembl: ENSOCUG00000025015
LinkDB
Position
2:83674342..83698044
AA seq 448 aa
MVPEEDSAWMPWLPVLVVSLVCSARAEYTNCGENEYYNQTTGLCHACPPCGPGEEPYMSC
GYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPSAKECVGATSGASAHFPSTAGSSTLSPFQHAHKELTG
QGHLATALIIAMSTIFIMAIAIVLIIMFYMVKTKPSAPACCSSHPGKSVEAPVSKEEEKK
ESPDNVVIFSEKDEFEKLTATPAKTTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKPASCSKAAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESLCADILDWAGAVPPASQPPIAS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggtccccgaggaagactcggcgtggatgccctggctccctgtcctggtggtgtccctc
gtgtgctcggccagggcggagtacaccaactgtggggagaacgagtactacaaccagacc
acggggctgtgccacgcgtgtcccccctgtggaccaggggaagagccctacatgtcctgc
ggctacggcaccaaagacgaggactacggctgtgtcccctgcccagcggagaagttttcc
aaaggaggctaccagatatgcaggcgtcacaaggactgcgagggcttcttccgggccacc
gtgctgacgccgggggacatggagaatgacgccgagtgtgggccctgcctgcctggctac
tacatgctggaaaacagacccaggaacatctacggcatggtgtgctactcctgcctcctg
gcaccccccagcgccaaggaatgtgtgggagccacgtcgggagcttctgcccacttcccc
agcaccgctggcagcagcacgctgtctcccttccagcacgcccacaaagagctcacaggc
caaggccacctggccaccgccctgatcatcgccatgtccaccatcttcatcatggccatc
gccatcgtgctcatcatcatgttctacatggtgaagaccaagccctccgccccagcctgc
tgcagcagccacccagggaagagcgtggaggcccccgtgagcaaagaggaggagaagaag
gagtctccagacaacgtggtgattttctcggagaaggacgagttcgagaagctcacagca
actccagccaagaccaccaagagcgagaatgacgcctcgtcggagaacgagcagctgctg
agccgcagcgtggacagtgatgaggagcccgccccggacaagcagggctccccagagctg
tgcctgctgtctctggtccacctggcccgggagaagcccgcctcctgcagcaaggcagcc
gggatccaaagccgaaggaaaaagatactggatgtgtatgccaacgtatgtggggtggta
gaaggtctcagtcccacggagctgccatttgactgtttggagaaaaccagccggatgctg
agctccacgtacaactccgagaaggccgtggtgaaaacctggcgccacctggccgagagc
tttggactgaagcgagacgagatcggcggcatgacggacgggatgcagctcttcgaccgc
atcagcaccgcgggctacagcatcccggagctgctcaccaagctggtgcagatcgagcgg
ctggacgccgtggagtccttgtgcgcggacatactggactgggcgggggccgtgccgcct
gcttcccagccccccattgcgtcctga

DBGET integrated database retrieval system