KEGG   Oryctolagus cuniculus (rabbit): 100358501
Entry
100358501         CDS       T03373                                 
Symbol
PRPF19
Name
(RefSeq) pre-mRNA processing factor 19
  KO
K10599  pre-mRNA-processing factor 19 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03040  Spliceosome
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100358501 (PRPF19)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100358501 (PRPF19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100358501 (PRPF19)
   04121 Ubiquitin system [BR:ocu04121]
    100358501 (PRPF19)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100358501 (PRPF19)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100358501 (PRPF19)
Spliceosome [BR:ocu03041]
 Complex B
  Other components
   Prp19 complex
    100358501 (PRPF19)
 Complex C
   Prp19-CDC5 complex
    100358501 (PRPF19)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   100358501 (PRPF19)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    100358501 (PRPF19)
SSDB
Motif
Pfam: WD40 Prp19 ANAPC4_WD40 NBCH_WD40 U-box eIF2A Ge1_WD40 Nup160 Cytochrom_D1 zf-Nse DUF1830 Cep57_MT_bd
Other DBs
NCBI-GeneID: 100358501
NCBI-ProteinID: XP_008270268
Ensembl: ENSOCUG00000015689
UniProt: G1TA04
LinkDB
Position
1:complement(193523688..193533517)
AA seq 504 aa
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
IRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKA
TVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQ
VVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHP
DGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtccctgatctgctctatctccaatgaagtgccagaacacccgtgcgtgtcccccgtc
tctaatcacgtctacgagcggcggctcatagagaagtacattgctgagaatggtacagac
cccattaacaaccagcctctctccgaggagcagctcatcgacatcaaagttgcccaccca
atccggcccaagcccccctcagccaccagcatcccagccatcctgaaagccttgcaggat
gagtgggacgcggtcatgctgcacagcttcactctgcgtcagcagctgcagacgacccgc
caggagctgtcccacgctctgtaccagcacgatgccgcctgccgtgtcattgcccgtctc
accaaggaagtcactgccgcccgagaagctctggctaccctgaaaccacaggctggtctc
atcgtgccccaggctgtgccaagttcacagccaagtgtggtgggtgcaggcgaacccatg
gatttgggtgagctggtgggaatgactcccgaaattatccagaagcttcaagacaaggcc
actgtgctgaccacggagcgtaagaagagagggaagactgtgcctgaggagctggtgaag
ccggaagagctcagcaaataccggcaggtggcatcccacgtggggttgcacagtgccagc
attcccgggatcctcgccctggatctctgtccctccgacaccaacaagatcctcactggt
ggggcggataaaaatgttgtcgtctttgacaagagctctgagcaaatcctggccaccctc
aaaggtcataccaagaaggtcaccagtgtggtgtttcacccttcccaggacttggtgttt
tctgcctctccagatgccactatcaggatttggtcggtcccgaacgcctcttgtgtccag
gttgttcgggcccatgagagcgctgtgacaggcctcagcctccatgccactggggactac
ctcctgagctcttcagatgaccagtactgggccttctctgacatccagacggggcgcgtg
ctcaccaaggtgacggatgagacctctggctgctctctcacctgtgcgcagttccaccct
gatggactcatttttggaacaggaactatggactctcagatcaagatctgggacttgaag
gagcgcaccaacgtggccaacttccctggccactcaggccccatcaccagcatcgccttc
tctgagaacggctactacctggctacggcagctgacgactcttctgtcaagctttgggat
ctgcgcaaactgaagaacttcaagacgctgcagctggataacaactttgaggtgaagtct
ctgatcttcgaccagagcggtacctacctggccctagggggcacagatgtccagatctac
atctgtaaacaatggacagagattcttcacttcacagagcacagcggcctgaccacaggg
gtggccttcgggcaccacgccaagttcatcgcttctacaggcatggacaggagcctcaag
ttctacagcctgtag

DBGET integrated database retrieval system