KEGG   Oryctolagus cuniculus (rabbit): 100358676
Entry
100358676         CDS       T03373                                 
Symbol
IL13
Name
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04664  Fc epsilon RI signaling pathway
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358676 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358676 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100358676 (IL13)
   04657 IL-17 signaling pathway
    100358676 (IL13)
   04664 Fc epsilon RI signaling pathway
    100358676 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358676 (IL13)
  09163 Immune disease
   05310 Asthma
    100358676 (IL13)
   05321 Inflammatory bowel disease
    100358676 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358676 (IL13)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100358676 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 100358676
NCBI-ProteinID: XP_002710138
LinkDB
Position
3:15690254..15692738
AA seq 187 aa
MSKDVVYRYVCQRRPGCWGVTTRAYKSCHRRPGPQSLSWASPHACSRSSSAALGSMALWW
AVAIAVTCLGSLVSPGPVPPPTSLKELIEELVNITHNQKAPLCNGTMVWSVNLTGSVYCA
ALESLVNVSGCNAIQRTQRMLSGLCTDKAVAKQVTSVQARDTKIELLQFLKELRRHLQML
YRLGKFR
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagtaaagatgtggtttatagatatgtctgccagcggagaccagggtgctggggcgtc
accactcgggcctataaaagctgccacaggaggccagggccacagtcgctcagctgggcc
agcccgcacgcctgctcccgatcctcctctgctgctctgggctccatggcgctctggtgg
gctgtggccattgctgtgacctgccttggcagcctcgtatccccaggccctgtgcctccc
cccacatccctcaaggagctcatcgaggagctggtcaacatcacacacaaccagaaggct
ccactctgcaatggcaccatggtgtggagcgtcaacctgacaggcagcgtgtactgcgca
gccctggagtccctcgtcaatgtctctggctgcaacgccatccagaggacccagcggatg
ctgagcggactctgcacagacaaggctgtggccaagcaggtcaccagcgtgcaagcgcga
gacaccaaaatcgaactgctgcagttcctgaaggagctgcgcaggcacctgcagatgctg
taccgcctggggaagttccgctga

DBGET integrated database retrieval system