KEGG   Oryctolagus cuniculus (rabbit): 100358749
Entry
100358749         CDS       T03373                                 

Name
(RefSeq) interleukin-15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358749
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358749
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100358749
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358749
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100358749
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100358749
   04090 CD molecules [BR:ocu04090]
    100358749
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100358749
CD molecules [BR:ocu04090]
 Proteins
  100358749
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100358749
NCBI-ProteinID: XP_017194776
Ensembl: ENSOCUG00000007203
UniProt: G1SSJ2
LinkDB
Position
Un
AA seq 272 aa
MARRRLRSFSAHAFLALLLPPAVTLGVTCPTPTSVEHAAIRVKSYNLSSRERYVCNSGFK
RKAGTSSLTECVFNKTTNIAYWTTPNLKCIRDPSLTHQRPVPPSTVVTARVTPQPESPSP
SGKGPATFSPESDTTVATGTAIVPGSQLMPSTSPSTGTTGVGSHESSQAPSQTTTKTLEP
TPSTSHETTDAHPYSSRDVTVAISTSVSLLGVVCVGFLLAYCLRPRQTSQPPGVEMETTE
AMPMTGRTSSREEDTENYHLTSETRGGVFQPN
NT seq 819 nt   +upstreamnt  +downstreamnt
atggcccggagacggctccgctccttctcggcccacgccttccttgcgctgctgctcccg
ccagcggtgacactgggtgtcacatgccccacgcccacatctgttgaacatgcagccatc
cgggtcaagagttacaacttgagctccagggagcggtatgtttgtaactcaggtttcaag
cgtaaagccgggacatccagcctgacggagtgtgtgtttaacaaaaccacaaacattgcc
tactggacaactcccaatctcaagtgcatcagagacccctccctgactcaccaaaggcca
gtgccaccctccactgtagtgacggcaagggtgaccccacagccagagagcccctcccct
tctggaaaaggcccagccacattctctccagagtcagacaccacagtggccacagggaca
gctattgtaccaggctcccagctgatgccatccacgtcaccttccacaggaaccacgggg
gtaggcagtcatgagtcctcccaagccccatctcagacaacaacaaagaccttggaaccc
acgccctccacctcccacgagacaacagatgctcatccgtacagttccagagacgtcact
gtggccatctccacatctgtctcgctgctgggtgtagtgtgtgtggggttcctcctggcg
tattgcctcagaccaaggcaaacttcccagccacctggtgttgaaatggaaaccacagaa
gcaatgccaatgactgggcgcaccagtagcagagaggaagacacagaaaactaccacctg
acctctgaaactcgtggtggggtgttccagcccaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100359262
Entry
100359262         CDS       T03373                                 

Symbol
IL15RA
Name
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100359262 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100359262 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100359262 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100359262 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100359262 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100359262 (IL15RA)
   04090 CD molecules [BR:ocu04090]
    100359262 (IL15RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100359262 (IL15RA)
CD molecules [BR:ocu04090]
 Proteins
  100359262 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100359262
NCBI-ProteinID: XP_008249717
Ensembl: ENSOCUG00000006248
UniProt: G1SQM0
LinkDB
Position
Un
AA seq 262 aa
MARRRLRSFSAHAFLALLLPPAVTLGVTCPTPTSVEHAAIRVKSYNLSSRERYVCNSGFK
RKAGTSSLTECVFNKTTNIAYWTTPNLKCIRDPSLTHQRPVPPSTVVTARVTPQPESPSP
SGKGPATFSPESDTTVATGTAIIPGSQLMPSTSPSTGTTGIGSHESSQAPSQTTTKTLEP
TPSTSHETTDAHPYSSRDVTVAISTSVSLLGVVCVGFLLAYCLRPRQTSQPPGVEMETTE
AMPMTGCTSSREEDTENYPPDL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcccggagacggctccgctccttctcggcccacgccttccttgcgctgctgctcccg
ccagcggtgacactgggtgtcacatgccccacgcccacatctgttgaacatgcagccatc
cgggtcaagagttacaacttgagctccagggagcggtatgtttgtaactcaggtttcaag
cgtaaagccgggacatccagcctgacggagtgtgtgtttaacaaaaccacaaacattgcc
tactggacaactcccaatctcaagtgcatcagagacccctccctgactcaccaaaggcca
gtgccaccctccactgtagtgacggcaagggtgaccccacagccagagagcccctcccct
tctggaaaaggcccagccacattctctccagagtcagacaccacagtggccacagggaca
gctattataccaggctcccagctgatgccatccacgtcaccttccacaggaaccacaggg
ataggcagtcatgagtcctcccaagccccatctcagacaacaacaaagaccttggaaccc
acgccctccacctcccacgagacaacagatgctcatccgtacagttccagagacgtcact
gtggccatctccacatctgtctcgctgctgggtgtagtgtgtgtggggttcctcctggca
tattgcctccgaccaaggcaaacttcccagccacctggtgttgaaatggaaaccacagaa
gcaatgccaatgactgggtgcaccagtagcagagaggaagacacagaaaactacccacct
gacctctga

DBGET integrated database retrieval system