KEGG   Oryctolagus cuniculus (rabbit): 100358886
Entry
100358886         CDS       T03373                                 
Symbol
PARK2
Name
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  parkin [EC:2.3.2.31]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04137  Mitophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100358886 (PARK2)
   04120 Ubiquitin mediated proteolysis
    100358886 (PARK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100358886 (PARK2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100358886 (PARK2)
   05014 Amyotrophic lateral sclerosis
    100358886 (PARK2)
   05022 Pathways of neurodegeneration - multiple diseases
    100358886 (PARK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358886 (PARK2)
   04121 Ubiquitin system [BR:ocu04121]
    100358886 (PARK2)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100358886 (PARK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     100358886 (PARK2)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    100358886 (PARK2)
  Aggrephagy
   Other aggrephagy associated proteins
    100358886 (PARK2)
  Xenophagy
   Other xenophagy associated proteins
    100358886 (PARK2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    100358886 (PARK2)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    100358886 (PARK2)
SSDB
Motif
Pfam: zf-RING_14 zf-RING_12 ubiquitin IBR Rad60-SLD Rad60-SLD_2 Dsc3_N Crinkler Blt1
Other DBs
NCBI-GeneID: 100358886
NCBI-ProteinID: XP_017200966
LinkDB
Position
12:complement(150504051..151879506)
AA seq 464 aa
MIVFVRFNSSHGFPVEVDSDTSISQLKEAVAKRQGVPADQLRVIFAGKELGDESTVQNCD
LEQQSIVHVVQRPQRKGPETNTPGGDNPRRTSGGFQREPASLTRVDLSSDMLPAVSVGLA
VILDANGSRGSAAAGSPGRPTYNSFYVYCKGPCQRVQPGKLRVQCGTCRQATLTLAQGPS
CWEDVLGPNRMHGECQAPNCPGTRAEFFFKCGAHPTSDKETSVALNLITTNSRNISCITC
TDIRNPVLVFQCSQRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVASCPGXLLKSF
HHFRLLGQEDYGRYQQYGAEECVLQMGGVLCPSPRCGAGLLPEPGQRRVTCEGGGGLGCG
FIFCRDCKDAYHEGECSAPSEASGAGAQAYRVDERAAELARWEEASKDTIQKTTKPCPRC
HVPVEKNGGCMHMKCPQSQCRLEWCWHCGCEWNRTCMGDHWFDV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatagtgttcgtcaggttcaactccagccacggtttcccagtggaggtcgattctgac
accagcatctcccagctcaaggaggcggttgctaagcgacagggggttccagctgaccag
ttgcgtgtgatcttcgcagggaaggagcttggggatgagtcaacagtgcagaactgtgac
ctggaacagcagagcattgttcatgttgtgcagcgaccacagagaaaaggtccagagacc
aacacgcctggaggagacaaccccagaaggacctcaggaggcttccagagggagccagcg
agcttaacacgcgtggacctcagcagcgacatgctgccggcagtctccgtggggctggct
gttattctggatgccaatggcagcaggggctcagcagcagctggaagtccaggtagacca
acctacaacagcttctatgtttactgcaagggcccctgtcaaagagtgcagccaggaaaa
ctcagagttcaatgtggcacctgcagacaagcgaccctcaccttggcccagggcccatct
tgctgggaagatgtcttgggtccaaaccggatgcatggtgaatgccaagccccaaactgc
cctgggaccagagcagaatttttctttaaatgtggagcacacccgacctctgacaaggaa
acatcagtagctttgaacctgatcacaaccaacagtcgcaacatctcttgcataacctgc
acggacataaggaaccctgtcctggtcttccagtgcagccagcgccacgtgatttgcttg
gactgtttccacttgtactgtgtgacacggctcaacgatcggcagtttgtccacgacccg
cagcttggctactccctgccctgtgtggcctcctgtcctggataactactcaaaagtttc
catcatttcaggcttttgggacaggaagattacggccggtaccagcagtatggagcggag
gagtgtgtcctgcagatgggcggcgtgctgtgccccagccccaggtgtggagcagggctg
ctgcccgagccaggccagaggagagtcacctgcgagggaggcggcggtctgggctgcggg
ttcatcttctgccgcgactgtaaggacgcctaccacgaaggggaatgcagtgcaccgtct
gaggcatcaggagccggagctcaggcctacagggtggacgagagagccgcggagctcgct
cgctgggaagaggcctccaaggacaccatccagaaaaccaccaagccctgtccgcggtgc
cacgtgccggtggagaaaaacggaggatgcatgcacatgaagtgtccgcagtcccagtgc
cggcttgagtggtgctggcactgcggctgcgagtggaaccgcacctgcatgggcgaccac
tggttcgacgtgtag

DBGET integrated database retrieval system