KEGG   Oryctolagus cuniculus (rabbit): 100358914
Entry
100358914         CDS       T03373                                 
Symbol
LIF
Name
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
ocu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358914 (LIF)
   04668 TNF signaling pathway
    100358914 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358914 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100358914 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358914 (LIF)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100358914 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100358914
NCBI-ProteinID: NP_001232852
Ensembl: ENSOCUG00000003768
LinkDB
Position
Un
AA seq 202 aa
MKILAAGVVPLLLVLHWKPGAGSPLPINPVNATCNTHHPCPSNLMSQIRSQLAQLNGTAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKVRLVELYRIVAYLGTALGNIT
RDQKTLNPTAHSLHSKLNATADTLRGLLSNVLCRLCSKYHVAHVDVAYGPDTSGKDVFQK
KKLGCQLLGKYKQVMAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaagatcttggcggcaggagtcgtgcccctgctgctggtcttgcactggaaacccggg
gcggggagcccccttcccatcaaccccgtcaacgccacctgcaacacacaccacccatgc
cccagcaacctcatgagccagatcaggagccagctggcacagctcaatggcactgccaac
gccctctttattctctattacacagcccaaggggagccgttccccaacaacctggacaag
ctgtgcggccccaatgtgacggacttcccgcccttccacgccaacggcacggagaaggtc
aggctggtggagctgtaccgcatcgtcgcctaccttggcaccgccctgggcaacatcacc
cgggaccagaagaccctcaaccccacggcgcacagcctgcacagcaaactcaacgccacg
gcggacacgctgcggggcctgcttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtggcctatggcccggacacctcgggcaaggacgtcttccagaag
aagaagctggggtgtcagctgctgggaaaatacaagcaggtcatggccgtgttggcgcag
gccttctag

DBGET integrated database retrieval system