KEGG   Oryctolagus cuniculus (rabbit): 100359243
Entry
100359243         CDS       T03373                                 
Symbol
MVB12B
Name
(RefSeq) multivesicular body subunit 12B
  KO
K12186  ESCRT-I complex subunit MVB12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100359243 (MVB12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100359243 (MVB12B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    100359243 (MVB12B)
SSDB
Motif
Pfam: DUF2464
Other DBs
NCBI-GeneID: 100359243
NCBI-ProteinID: XP_008271518
Ensembl: ENSOCUG00000014336
UniProt: G1T771
LinkDB
Position
Un
AA seq 330 aa
MPEVKDLSEALPDTSMDPLTGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVT
RYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFI
PRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSA
ASTPAPNLPRHISLTLPATFRGRNSARTDYEYQHSNLYAISGDSLRAEGAHKLARDYPGP
PGRASEHTGEVVSRGHLPAHALNAMDGVPFMISEKFSCVPESMQPFDLLGITIKSLAEIE
KEYEYSFRTEQSAAARLPPSPTRCQQVPQS
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcctgaagtgaaagacctctcggaagccttgccggacacctcgatggaccccctcacg
ggggtcggggtggtggcttcgcggaaccgcgccccgacaggctacgacgtggtcgcacag
acggcagatggcgtggacgctgacctctggaaagacggcttatttaagtccaaggtcacc
agatacctgtgtttcacgagatcgttttccaaagaaaacagccacctggggaacgtgtta
gtggatatgaagctcattgacatcaaggacacgctgcctgtgggcttcatcccgattcag
gagacggtggacacacaggaggtggcttttagaaagaagaggctgtgcatcaagttcatc
ccccgggactcgacggaagccgccatctgtgacattcggatcatgggccggaccaagcag
gcccctcctcagtacacgttcatcggggaactgaacagcatggggatctggtatcgaatg
ggcagagtcccaagaaaccatgactcatctcaacccacgacgccttcccagtcgtcagct
gcttctaccccagcccccaacctgcccaggcacatctctctaacgctccctgccaccttc
cgaggcaggaacagcgcgcggacggactatgagtaccagcactccaatttgtatgccata
tcaggtgactcgctaagagccgagggagcccacaaactcgcccgcgattaccctgggccg
ccaggcagggcgtcggaacacacgggggaggtggtaagtcggggccacttaccagcacac
gcccttaatgcaatggatggggtgccgttcatgatatcagagaagttttcgtgcgttcca
gaaagtatgcagccctttgacctcttgggaatcactatcaagtctttggcagaaatcgaa
aaagagtacgagtacagcttccgcacggagcagagcgccgcggcccggctgccgcccagc
cctaccaggtgtcagcaggtgccgcagtcctga

DBGET integrated database retrieval system