KEGG   Oryctolagus cuniculus (rabbit): 103345363
Entry
103345363         CDS       T03373                                 
Symbol
RAB8A
Name
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04140  Autophagy - animal
ocu04144  Endocytosis
ocu04152  AMPK signaling pathway
ocu04530  Tight junction
ocu04972  Pancreatic secretion
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103345363 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103345363 (RAB8A)
   04140 Autophagy - animal
    103345363 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103345363 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    103345363 (RAB8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103345363 (RAB8A)
   05022 Pathways of neurodegeneration - multiple diseases
    103345363 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103345363 (RAB8A)
   03036 Chromosome and associated proteins [BR:ocu03036]
    103345363 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    103345363 (RAB8A)
   04031 GTP-binding proteins [BR:ocu04031]
    103345363 (RAB8A)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    103345363 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    103345363 (RAB8A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    103345363 (RAB8A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103345363 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   103345363 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   103345363 (RAB8A)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    103345363 (RAB8A)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU DUF3963 AAA_7 AAA_16
Other DBs
NCBI-GeneID: 103345363
NCBI-ProteinID: XP_017193545
LinkDB
Position
Un
AA seq 213 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSRERERKAGPRLWDQVHGDQCEGQHQRGERLLHARQRHQSKNGQKIGGQ
QPPGQQPGSAHHLGPAEEEQLLPLCPPVRTASL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc
ataggaatcgactttaaaattaggaccatagaactcgatggcaaaagaattaaactacag
atatgggacacggctggccaggagcggtttcggaccatcaccacagcctactacaggggt
gcaatgggtatcatgctggtttatgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcggaacattgaggagcacgcctccgcagacgtggaaaagatgatcttgggg
aacaagtgcgacgtgaacgacaagcgacaagtttccagggagcgggagagaaaagctggc
cctcgattatgggatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaa
cgccttcttcacgctcgccagagacatcaaagcaaaaatggacaaaaaattggagggcag
cagcccccagggcagcagccagggagtgcgcatcacctcggaccagcagaagaggagcag
cttcttccgctgtgtcctcctgtgaggaccgcctcgctctga

DBGET integrated database retrieval system