Oryctolagus cuniculus (rabbit): 103345363 Help Entry 103345363         CDS       T03373                                  Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04140   Autophagy - animal ocu04144   Endocytosis ocu04152   AMPK signaling pathway ocu04530   Tight junction ocu04972   Pancreatic secretion ocu05014   Amyotrophic lateral sclerosis ocu05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     103345363  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103345363    04140 Autophagy - animal     103345363   09144 Cellular community - eukaryotes    04530 Tight junction     103345363  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     103345363  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103345363    05022 Pathways of neurodegeneration - multiple diseases     103345363  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     103345363    03036 Chromosome and associated proteins [BR:ocu03036]     103345363   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     103345363    04031 GTP-binding proteins [BR:ocu04031]     103345363 Membrane trafficking [BR:ocu04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     103345363  Autophagy   Other autophagy associated proteins     103345363 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     103345363 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103345363   Exosomal proteins of other body fluids (saliva and urine)    103345363   Exosomal proteins of colorectal cancer cells    103345363 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     103345363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  103345363 NCBI-ProteinID:  XP_051691752 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGS SPQGSSQGVRITSDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaatcgactttaaaattaggaccatagaactcgatggcaaaagaattaaactacag atatgggacacggctggccaggagcggtttcggaccatcaccacagcctactacaggggt gcaatgggtatcatgctggtttatgacatcaccaacgagaagtccttcgacaacatccgg aactggattcggaacattgaggagcacgcctccgcagacgtggaaaagatgatcttgggg aacaagtgcgacgtgaacgacaagcgacaagtttccaaggagcggggagaaaagctggcc ctcgattatgggatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaac gccttcttcacgctcgccagagacatcaaagcaaaaatggacaaaaaattggagggcagc agcccccagggcagcagccagggagtgcgcatcacctcggaccagcagaagaggagcagc ttcttccgctgtgtcctcctgtga

DBGET integrated database retrieval system