KEGG   Oryctolagus cuniculus (rabbit): 103345447
Entry
103345447         CDS       T03373                                 
Symbol
CXCL17
Name
(RefSeq) C-X-C motif chemokine ligand 17
  KO
K22627  C-X-C motif chemokine 17
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345447 (CXCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345447 (CXCL17)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103345447 (CXCL17)
SSDB
Motif
Pfam: CXCL17
Other DBs
NCBI-GeneID: 103345447
NCBI-ProteinID: XP_008247912
LinkDB
Position
Un
AA seq 203 aa
MNSEEAWVPPLLRSFTSQIPVKHVVQSETLPQRQSHLTCSCPGIKAQTARPSTPPEPLQE
GSHLRPGTLGILLKRPAVAPMAPEKVLIPSLLLLLSLLLMPTVSSTPHSGVARGHGDQRQ
TSGRWLWEDGQECECKGWFLRAPKRKLMTVPRLPKKHCPCDHFKGTVKKTRGHQKSHRQP
NKHSRACQQFLKRCQLASFALPL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaacagcgaggaggcctgggttcctccactgctccggagtttcacctctcagattccc
gtaaaacatgttgtccaatctgaaaccttaccacaacgacagagtcaccttacctgttcc
tgccctgggattaaagcccagacggcccgcccgagtaccccacctgagcctctgcaagaa
ggcagccatctccgacccggaacactcggcatactcctcaagcgacctgcagtagcaccc
atggccccagagaaggttctaatcccctccctcctgctgctgctgtcgctactgctgatg
cccacggtctctagcaccccacattcaggggtcgccagaggccatggggaccaacgccaa
acttcagggaggtggctctgggaagatggccaagaatgtgagtgcaaaggttggttcctg
agagccccgaaaagaaaactcatgacagtgcctaggctgccaaagaagcactgtccctgt
gatcacttcaaaggcacggtgaagaaaaccagagggcatcaaaagtcccacaggcagcca
aacaagcactccagagcctgtcagcagtttctcaaacgatgtcaactagcaagctttgct
ctgcccttgtaa

DBGET integrated database retrieval system